| Clone Name | rbasd2m01 |
|---|---|
| Clone Library Name | barley_pub |
>ACO32_ARATH (Q9LMI7) Putative acyl-coenzyme A oxidase 3.2, peroxisomal| precursor (EC 1.3.3.6) Length = 675 Score = 59.7 bits (143), Expect = 4e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 467 PHALAIVGSFGIPDAFLSPLAFDWIEANALSS 372 PHALA+V SFGIPDAFLSP+AF+W+EANA SS Sbjct: 643 PHALALVASFGIPDAFLSPIAFNWVEANAWSS 674
>ACOX3_ARATH (Q9LLH9) Acyl-coenzyme A oxidase 3, peroxisomal precursor (EC| 1.3.3.6) (AOX 3) (Medium-chain acyl-CoA oxidase) (AtCX3) Length = 675 Score = 57.8 bits (138), Expect = 2e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -2 Query: 467 PHALAIVGSFGIPDAFLSPLAFDWIEANALSS 372 PHALA+V SFGIPD+FLSP+AF+W+EANA SS Sbjct: 643 PHALALVTSFGIPDSFLSPIAFNWVEANAWSS 674
>MTPC1_ARATH (Q8L725) Metal tolerance protein C1 (AtMTPc1)| Length = 471 Score = 32.7 bits (73), Expect = 0.57 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 7/79 (8%) Frame = +1 Query: 124 YQLIQFYRRNLEKT---VHEFSMHQIPYFLRRSASSTVHFN----NDYCKPCKRQEATNA 282 +++ ++ RR + V E +H P FL+ S S+ H + ++ C+ K EAT + Sbjct: 340 HEVGEYVRRQINLNHPEVSEVFIHIDPAFLQFSCSTKDHDSITKESNICQEIKHVEATVS 399 Query: 283 PVFGCPICNSFTFKGLRPH 339 +F + T K + PH Sbjct: 400 DIFSSQLSEKLTIKRITPH 418
>VE1_HPV1A (P03111) Replication protein E1 (EC 3.6.1.-) (ATP-dependent| helicase E1) Length = 612 Score = 29.3 bits (64), Expect = 6.3 Identities = 13/58 (22%), Positives = 31/58 (53%) Frame = +2 Query: 17 WLIALCTIQQHIVKKERIYSKQHCIHYLRCEHLLVHISLFSFIGVI*RRQSMNSACIK 190 W++A+ ++++++ + + HC+ Y++ EH + + F F+ V + Q IK Sbjct: 198 WVLAVWGVRENLIDSVKELLQTHCV-YIQLEHAVTEKNRFLFLLVRFKAQKSRETVIK 254
>YRMC_CAEEL (Q6BEV5) Hypothetical protein R06F6.12| Length = 417 Score = 28.9 bits (63), Expect = 8.2 Identities = 19/74 (25%), Positives = 32/74 (43%), Gaps = 18/74 (24%) Frame = +1 Query: 157 EKTVHEFSMHQIPYFLRRSASSTVH-------FNNDYCKPCKRQEATNAPV--------- 288 +++ HE+ P LRR+ ++V N+D C P ++ APV Sbjct: 315 DRSDHEYQQVAPPVLLRRTDMASVRNAAQKRSANDDLCPPVLKKSYQLAPVVDGPHLVHT 374 Query: 289 --FGCPICNSFTFK 324 F CPIC+ ++ Sbjct: 375 PNFCCPICDKKVYQ 388
>YAC5_SCHPO (Q09819) Hypothetical protein C16C9.05 in chromosome I| Length = 404 Score = 28.9 bits (63), Expect = 8.2 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +1 Query: 235 NNDYCKPCKRQEATNAPVFGCPICNSFTFKGLRPH 339 N YC C + V+GC +C++F K + H Sbjct: 237 NLAYCGYCSKPSMGACWVYGCQLCDTFYHKNCKEH 271
>NXS7_PSETE (Q9W7J6) Short neurotoxin 7 precursor (Alpha neurotoxin 7)| Length = 79 Score = 28.9 bits (63), Expect = 8.2 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -1 Query: 495 VMILCSELRAPCACYCRFFRNP*CFPQST-CFR 400 V I+C +L CY R+F C PQ T C+R Sbjct: 11 VTIMCLDLGYTLTCYKRYFDTVVCKPQETICYR 43 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,751,317 Number of Sequences: 219361 Number of extensions: 1323958 Number of successful extensions: 3208 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3207 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)