| Clone Name | rbasd2l22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YO125_YEAST (Q12383) Uncharacterized protein YOL125W | 42 | 0.002 | 2 | WRB_MOUSE (Q8K0D7) Tryptophan-rich protein | 33 | 0.87 | 3 | WRB_RAT (Q6P6S5) Tryptophan-rich protein | 31 | 3.3 | 4 | HEMA_IADH5 (P12586) Hemagglutinin precursor [Contains: Hemagglut... | 29 | 9.7 | 5 | LET23_CAEEL (P24348) Receptor tyrosine-protein kinase let-23 pre... | 29 | 9.7 |
|---|
>YO125_YEAST (Q12383) Uncharacterized protein YOL125W| Length = 476 Score = 41.6 bits (96), Expect = 0.002 Identities = 23/64 (35%), Positives = 30/64 (46%), Gaps = 10/64 (15%) Frame = +1 Query: 340 IVIALCCHHRCDWHHYVGREFFQSLGLDQRE----------FNLFQRMSSWATCGMRKLP 489 I IA+CC H CD+ YV R + SL R F + ++ SW TCG + P Sbjct: 342 ICIAMCCRHVCDYGDYVNRSYVTSLVEKYRAHGSILTYETFFRVLTKLCSWGTCGRK--P 399 Query: 490 AKAI 501 AI Sbjct: 400 GTAI 403
>WRB_MOUSE (Q8K0D7) Tryptophan-rich protein| Length = 174 Score = 32.7 bits (73), Expect = 0.87 Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 3/56 (5%) Frame = -2 Query: 342 NASRTGRTNWICFLAFIFYCFLLQMICP--GSFLAKV-QRWQESYSA*DSAVPGLQ 184 +AS T R W+ L+F+F C LL+++ P SF+++V Q+ E S + + G++ Sbjct: 2 SASETDRWAWLLVLSFVFGCNLLRILLPSLSSFISRVLQKDAEQESQMRAEIQGMK 57
>WRB_RAT (Q6P6S5) Tryptophan-rich protein| Length = 174 Score = 30.8 bits (68), Expect = 3.3 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = -2 Query: 342 NASRTGRTNWICFLAFIFYCFLLQMICP--GSFLAKV 238 +AS T R W+ L F+F C +L+++ P SF+++V Sbjct: 2 SASETDRWAWLLVLCFVFGCNVLRILLPTLSSFISRV 38
>HEMA_IADH5 (P12586) Hemagglutinin precursor [Contains: Hemagglutinin HA1| chain; Hemagglutinin HA2 chain] (Fragment) Length = 550 Score = 29.3 bits (64), Expect = 9.7 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -2 Query: 333 RTGRTNWICFLAFIFYCFLLQMICPGSFLAKVQR 232 ++G NWI +++F CFLL ++ G + QR Sbjct: 508 KSGYKNWILWISFAISCFLLCVVLLGFIMWAYQR 541
>LET23_CAEEL (P24348) Receptor tyrosine-protein kinase let-23 precursor (EC| 2.7.10.1) (Lethal protein 23) Length = 1367 Score = 29.3 bits (64), Expect = 9.7 Identities = 21/88 (23%), Positives = 40/88 (45%), Gaps = 5/88 (5%) Frame = +1 Query: 199 CAVSCRVTFLPPLNLCQKRPRTDHLQQETVKNEG--KEAYPVSSACAGGIVIALC--CHH 366 C++SC+ N+ Q + H++ + +E + PV+S +C CHH Sbjct: 740 CSISCKTCSSAGRNVVQNKCVCKHVEYQPNPSERICMDQCPVNSFMVPDTNNTVCKKCHH 799 Query: 367 RCDWHHYVGREFFQSLGLDQ-REFNLFQ 447 CD +++ QS G + + F +F+ Sbjct: 800 ECDQNYHCANG--QSTGCQKCKNFTVFK 825 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,940,180 Number of Sequences: 219361 Number of extensions: 1764980 Number of successful extensions: 4285 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4201 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4281 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5596027262 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)