ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal8o05 |
|---|---|
| Clone Library Name | barley_pub |
>RR4_PINTH (P41638) Chloroplast 30S ribosomal protein S4| Length = 198 Score = 33.5 bits (75), Expect = 0.48 Identities = 21/65 (32%), Positives = 33/65 (50%) Frame = +2 Query: 179 RSNNLPADKRCQSKYRRDAQNRASHHNKMVTVYRTRKVAGADVVLHMRLLHRQLARPCRV 358 R LP + K R+D+ NR+S ++ ++ YR R + H L RQL + R+ Sbjct: 14 RLKTLPGLTSKRPKNRKDSMNRSS--SRKISQYRIRLEEKQKLRFHYGLTERQLLKYVRI 71 Query: 359 ANRAQ 373 A RA+ Sbjct: 72 ARRAK 76
>RR4_PINKO (Q85WX8) Chloroplast 30S ribosomal protein S4| Length = 228 Score = 31.6 bits (70), Expect = 1.8 Identities = 19/65 (29%), Positives = 30/65 (46%) Frame = +2 Query: 179 RSNNLPADKRCQSKYRRDAQNRASHHNKMVTVYRTRKVAGADVVLHMRLLHRQLARPCRV 358 R LP + K R+D+ N ++ ++ YR R + H L RQL + RV Sbjct: 14 RLKTLPGLTSKRPKNRKDSMNMNRSSSRKISQYRIRLEEKQKLRFHYGLTERQLLKYVRV 73 Query: 359 ANRAQ 373 + RA+ Sbjct: 74 SRRAK 78
>HSP1_THYCY (P67846) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_SMIYO (Q71UF8) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_SMIVI (Q71UF9) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_SMIPS (Q71UG0) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_SMIOO (Q71UG1) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_SMIMU (Q71VP9) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_SMIMA (Q71VP8) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_SMILO (Q9TUC2) Sperm protamine P1| Length = 61 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_SMILE (Q71UG2) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_SMIHI (Q71UG3) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_SMIGR (Q9TUC3) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_SMIGI (Q71UG5) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_SMIGA (Q71UG4) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_SMIDO (Q71UG6) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_SMIDL (Q71UG7) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_SMICR (P67844) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_SMIBI (Q9TUC4) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_SMIAR (Q71UG8) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_SMIAI (Q71UG9) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_PLAMM (Q71VP4) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_PHATA (P67847) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_PHACL (Q71V10) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_NINYV (Q71VP6) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_NINTI (Q71VP5) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_NINRI (Q71VP7) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_MYRFA (P67845) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_MURRO (Q71V11) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_MURLO (P67848) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_DASCR (Q71VG8) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_ANTSW (Q71V22) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_ANTST (P42129) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_ANTNA (Q71V12) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_ANTMI (Q71V19) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_ANTME (Q71V14) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_ANTLE (Q71V16) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_ANTHA (Q71V13) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_ANTGO (Q71V17) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_ANTFL (Q71V20) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>HSP1_ANTBE (Q71V18) Sperm protamine P1| Length = 62 Score = 30.0 bits (66), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 206 RCQSKYRRDAQNRASHHNKMVTVYRTRK 289 R +S+YRR + R+ HHN+ T R+R+ Sbjct: 10 RSRSRYRRRRRRRSRHHNRRRTYRRSRR 37
>UBP30_HUMAN (Q70CQ3) Ubiquitin carboxyl-terminal hydrolase 30 (EC 3.1.2.15)| (Ubiquitin thioesterase 30) (Ubiquitin-specific-processing protease 30) (Deubiquitinating enzyme 30) Length = 517 Score = 29.6 bits (65), Expect = 6.9 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -1 Query: 403 PVEYNTFHDGLSSVGNAAWSG*LTMEKSHVKHYICSCDFSRAIYCDH 263 PV ++TF S+ A W LT++ H H+ S + R + CD+ Sbjct: 242 PVRFDTFDSLSLSIPAATWGHPLTLD--HCLHHFISSESVRDVVCDN 286 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,072,107 Number of Sequences: 219361 Number of extensions: 1845680 Number of successful extensions: 5060 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 4890 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5055 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5253413348 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
