| Clone Name | rbasd2k11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | WIR1A_WHEAT (Q01482) WIR1A protein | 32 | 0.003 | 2 | DNAJ_BRUOV (Q05980) Chaperone protein dnaJ | 32 | 1.5 | 3 | ZAN_RABIT (P57999) Zonadhesin (Fragment) | 30 | 7.5 | 4 | RS3_LISMO (P66548) 30S ribosomal protein S3 | 30 | 7.5 | 5 | RS3_LISMF (Q71WF2) 30S ribosomal protein S3 | 30 | 7.5 | 6 | RS3_LISIN (P66549) 30S ribosomal protein S3 | 30 | 7.5 | 7 | COFD_MYCPA (Q73UJ4) LPPG:FO 2-phopspho-L-lactate transferase (EC... | 30 | 7.5 |
|---|
>WIR1A_WHEAT (Q01482) WIR1A protein| Length = 88 Score = 31.6 bits (70), Expect(2) = 0.003 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Frame = -1 Query: 569 SMGXFARAARFLVLLQIALF-VISAVIISGPVC 474 S+G A R VLLQIALF V++A+II+ VC Sbjct: 3 SLGSSAGGRRPTVLLQIALFVVVAAIIINSSVC 35 Score = 28.9 bits (63), Expect(2) = 0.003 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 394 SGQPYTRPGCGTVYKC 347 +GQPYT GC TVY C Sbjct: 65 AGQPYTGRGCRTVYGC 80
>DNAJ_BRUOV (Q05980) Chaperone protein dnaJ| Length = 375 Score = 32.0 bits (71), Expect = 1.5 Identities = 19/55 (34%), Positives = 23/55 (41%) Frame = +1 Query: 250 RTRQSHASTPWECDYSIVGEAGSAGARAEHLVGTCTRCRTQGECRAGQMVRTVHR 414 +T Q T CD E +GA+ TCT C G CRA Q +V R Sbjct: 134 KTAQIRVPTSITCD-----ECSGSGAKPGSQPTTCTMCSGSGRCRAAQGFFSVER 183
>ZAN_RABIT (P57999) Zonadhesin (Fragment)| Length = 2282 Score = 29.6 bits (65), Expect = 7.5 Identities = 30/100 (30%), Positives = 41/100 (41%), Gaps = 10/100 (10%) Frame = -3 Query: 444 CSGPRVVLCASVDGAHHLASPTLALGAAPCTS-------AHQ-VLSPSARRPRLPNNGVI 289 C GP V CAS+ G + +L L CTS H V + ++R ++GV+ Sbjct: 2102 CEGPCVEGCASLPGYAFSGAQSLPLANCGCTSNGIYYQLGHSFVTADCSQRCTCASSGVL 2161 Query: 288 ALPRRGCM-ALSCSQYQLLSGSYTEPNIIPCGRTD-MNDG 175 C SC+ L G + E PC R NDG Sbjct: 2162 LCEPFSCRPGESCTLGNLTRGCFRES---PCLRNPCQNDG 2198
>RS3_LISMO (P66548) 30S ribosomal protein S3| Length = 218 Score = 29.6 bits (65), Expect = 7.5 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 191 VRPHGMILGSV*DPDSNWYCEQDRA 265 V P GM +G + D DS WY E+D A Sbjct: 5 VHPIGMRIGVIRDWDSKWYAEKDYA 29
>RS3_LISMF (Q71WF2) 30S ribosomal protein S3| Length = 218 Score = 29.6 bits (65), Expect = 7.5 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 191 VRPHGMILGSV*DPDSNWYCEQDRA 265 V P GM +G + D DS WY E+D A Sbjct: 5 VHPIGMRIGVIRDWDSKWYAEKDYA 29
>RS3_LISIN (P66549) 30S ribosomal protein S3| Length = 218 Score = 29.6 bits (65), Expect = 7.5 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 191 VRPHGMILGSV*DPDSNWYCEQDRA 265 V P GM +G + D DS WY E+D A Sbjct: 5 VHPIGMRIGVIRDWDSKWYAEKDYA 29
>COFD_MYCPA (Q73UJ4) LPPG:FO 2-phopspho-L-lactate transferase (EC 2.7.1.-)| Length = 337 Score = 29.6 bits (65), Expect = 7.5 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 371 WVRHRVQVPTRCSALAPADPASPTME 294 WVR+R QVPT A A+ A+ T E Sbjct: 179 WVRYRAQVPTHSFAFVGAEKAAATTE 204 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,268,947 Number of Sequences: 219361 Number of extensions: 1854370 Number of successful extensions: 4873 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4658 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4873 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)