| Clone Name | rbasd2k09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MDL1_PRUDU (O24243) (R)-mandelonitrile lyase 1 precursor (EC 4.1... | 30 | 3.6 | 2 | TDP_DROME (Q24318) Transcription factor dp | 29 | 8.1 |
|---|
>MDL1_PRUDU (O24243) (R)-mandelonitrile lyase 1 precursor (EC 4.1.2.10)| (Hydroxynitrile lyase 1) ((R)-oxynitrilase 1) Length = 559 Score = 30.0 bits (66), Expect = 3.6 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 71 P*IGNFLLLNPRQYANSQPPSPL 139 P +G FL NPR + N+ PP+P+ Sbjct: 317 PYVGQFLYNNPRNFINNFPPNPI 339
>TDP_DROME (Q24318) Transcription factor dp| Length = 445 Score = 28.9 bits (63), Expect = 8.1 Identities = 14/39 (35%), Positives = 25/39 (64%) Frame = -1 Query: 459 LMSNLLIILVAACQSIRDEGKRKKPNKPGKVLRHFVLMI 343 + SN L + A+ S++ +++KP+K GK LRHF + + Sbjct: 142 IQSNSLHSMSASSSSVQ---RKRKPDKAGKGLRHFSMKV 177 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,705,031 Number of Sequences: 219361 Number of extensions: 1259471 Number of successful extensions: 2874 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2873 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)