| Clone Name | rbasd2j22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POF13_SCHPO (O94334) F-box protein pof13 | 32 | 1.6 | 2 | YPAH_PSELE (P52089) UPF0178 protein in pahZ1 5'region | 32 | 2.1 |
|---|
>POF13_SCHPO (O94334) F-box protein pof13| Length = 396 Score = 32.0 bits (71), Expect = 1.6 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 322 TLTPVIFGSYLVFRVCLDLVPLAQPAPKQCFTPRCPVNCC 441 TLT ++F+ LD +P P +C RCP+N C Sbjct: 223 TLTSNWHSRVILFQNALDALPTTHGNPVECDISRCPLNAC 262
>YPAH_PSELE (P52089) UPF0178 protein in pahZ1 5'region| Length = 154 Score = 31.6 bits (70), Expect = 2.1 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = -3 Query: 521 ISXXVVVRGEMPLEPRASWFSPKCVEAQQLTGHLGVKHCFGAGCASG 381 ++ V+ +G +PL PR W++ + AQQLT ++ G+G +G Sbjct: 78 LASLVLEKGGLPLNPRGEWYTKDTI-AQQLTMRAFMEELRGSGVDTG 123 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,848,049 Number of Sequences: 219361 Number of extensions: 1646360 Number of successful extensions: 3555 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3555 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5995743495 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)