| Clone Name | rbasd2i22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CU24_ARADI (P80516) Adult-specific rigid cuticular protein 12.4 ... | 32 | 1.2 | 2 | GUAA_SYNPX (Q7UA53) GMP synthase [glutamine-hydrolyzing] (EC 6.3... | 30 | 3.5 | 3 | UN84A_HUMAN (O94901) Sad1/unc-84 protein-like 1 (Unc-84 homolog A) | 29 | 7.8 |
|---|
>CU24_ARADI (P80516) Adult-specific rigid cuticular protein 12.4 (ACP 12.4)| Length = 126 Score = 32.0 bits (71), Expect = 1.2 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -2 Query: 419 MLCGEGVYSQSFNNNGIIAHSRVASGCVGPVIDDYIYGD 303 M G Y+ FN HSRV SG G + Y Y D Sbjct: 5 MTLAGGAYNFGFNTGDATGHSRVESGTAGSAVGSYSYID 43
>GUAA_SYNPX (Q7UA53) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)| (Glutamine amidotransferase) (GMP synthetase) Length = 528 Score = 30.4 bits (67), Expect = 3.5 Identities = 22/56 (39%), Positives = 26/56 (46%) Frame = +2 Query: 347 LPHGCVR*SHCC*MTVNTPLLRIASSQTRCRAHGNSPLLGVQSYYHGTHSTCNVFL 514 LP G VR +H T NTP +A Q R L GVQ + HSTC + L Sbjct: 147 LPEGFVRLAH----TANTPEAAVAHLQRR--------LYGVQFHPEVVHSTCGMAL 190
>UN84A_HUMAN (O94901) Sad1/unc-84 protein-like 1 (Unc-84 homolog A)| Length = 812 Score = 29.3 bits (64), Expect = 7.8 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +1 Query: 409 PHSIFSNSMSRPRKLSLVGCAILLPWY--SQYMQRVSSVPGRCHAH 540 P +F + SR K L G + PW+ S Q+V+S+ G+CH H Sbjct: 362 PQDVFKPTTSR-LKQPLQGDSEAFPWHWMSGVEQQVASLSGQCHHH 406 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,815,031 Number of Sequences: 219361 Number of extensions: 1650907 Number of successful extensions: 3599 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3597 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)