| Clone Name | rbasd2h22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CU24_ARADI (P80516) Adult-specific rigid cuticular protein 12.4 ... | 32 | 1.6 | 2 | DACT2_BRARE (Q673G8) Dapper homolog 2 (Frodo 2) | 31 | 2.8 | 3 | CN044_HUMAN (Q96MY7) Protein C14orf44 | 31 | 2.8 | 4 | GUAA_SYNPX (Q7UA53) GMP synthase [glutamine-hydrolyzing] (EC 6.3... | 30 | 4.8 |
|---|
>CU24_ARADI (P80516) Adult-specific rigid cuticular protein 12.4 (ACP 12.4)| Length = 126 Score = 32.0 bits (71), Expect = 1.6 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 419 MLCGEGVYSQSFNNNGIIAHSRVASGCVGPVIDDYIYGD 303 M G Y+ FN HSRV SG G + Y Y D Sbjct: 5 MTLAGGAYNFGFNTGDATGHSRVESGTAGSAVGSYSYID 43
>DACT2_BRARE (Q673G8) Dapper homolog 2 (Frodo 2)| Length = 837 Score = 31.2 bits (69), Expect = 2.8 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = -1 Query: 574 NDGTKGALVLSCERDTSQALKKHVACTVSTMVVGLHTQQGRVSVGATSSLRRCYAEK 404 +DG G+L SC S++L ++ ++ + GR S G T RRC A++ Sbjct: 135 SDGGSGSLSNSCTSVYSESLSSSSQTSLLPLLSTSYASHGRSSCGQTGVSRRCSADE 191
>CN044_HUMAN (Q96MY7) Protein C14orf44| Length = 647 Score = 31.2 bits (69), Expect = 2.8 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -2 Query: 615 CGYTSQCSSLLNVPTMAPRVRLCCPVSVTPPRH*RN 508 CG T +CSSL N+P+ PR + P PP R+ Sbjct: 126 CGSTRRCSSLNNLPSNIPRPQTQPPSGSRPPSQHRS 161
>GUAA_SYNPX (Q7UA53) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)| (Glutamine amidotransferase) (GMP synthetase) Length = 528 Score = 30.4 bits (67), Expect = 4.8 Identities = 22/56 (39%), Positives = 26/56 (46%) Frame = +2 Query: 347 LPHGCVR*SHCC*MTVNTPLLRIASSQTRCRAHGNSPLLGVQSYYHGTHSTCNVFL 514 LP G VR +H T NTP +A Q R L GVQ + HSTC + L Sbjct: 147 LPEGFVRLAH----TANTPEAAVAHLQRR--------LYGVQFHPEVVHSTCGMAL 190 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 101,060,647 Number of Sequences: 219361 Number of extensions: 2166169 Number of successful extensions: 4944 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4746 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4942 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6143359464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)