| Clone Name | rbasd2h03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TECT2_RAT (Q3B7D3) Tectonic-2 precursor | 32 | 1.5 | 2 | REGB_BPT4 (P13312) Ribonuclease (EC 3.1.-.-) (Gp61.9) | 30 | 5.9 |
|---|
>TECT2_RAT (Q3B7D3) Tectonic-2 precursor| Length = 700 Score = 31.6 bits (70), Expect = 1.5 Identities = 18/48 (37%), Positives = 22/48 (45%) Frame = -3 Query: 191 WKLEFRYCNPQKTLVLSSYDLIKQAKCLVGRSHKTPCLAPLNFSV*VY 48 WK +C+P +T S I Q LV SH CLA L V +Y Sbjct: 98 WKRGLDWCSPDETASFSEAPCIVQT-LLVSASHNASCLAHLLIQVEIY 144
>REGB_BPT4 (P13312) Ribonuclease (EC 3.1.-.-) (Gp61.9)| Length = 153 Score = 29.6 bits (65), Expect = 5.9 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -3 Query: 527 DFGKSLEPEPGRCRRTDGKKWRCWRKTIPNEKY 429 DF +E PGR TDG W + PNEK+ Sbjct: 92 DFIDGVEYRPGRLEITDGNLWLGFTVCKPNEKF 124 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,060,698 Number of Sequences: 219361 Number of extensions: 1446653 Number of successful extensions: 4146 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4099 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4146 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4430660157 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)