| Clone Name | rbasd2g18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PPCKC_CHICK (P05153) Phosphoenolpyruvate carboxykinase, cytosoli... | 30 | 2.1 | 2 | DEOC_BDEBA (Q6MGR8) Deoxyribose-phosphate aldolase (EC 4.1.2.4) ... | 28 | 8.0 | 3 | PAM17_CANGA (Q6FJJ0) Presequence translocated-associated motor s... | 28 | 8.0 |
|---|
>PPCKC_CHICK (P05153) Phosphoenolpyruvate carboxykinase, cytosolic [GTP] (EC| 4.1.1.32) (Phosphoenolpyruvate carboxylase) (PEPCK-C) Length = 622 Score = 29.6 bits (65), Expect = 2.1 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +3 Query: 78 QGDSKGHNPK*RQPQSSELVGCVMKSVAVCRGSRESGKLLLDL 206 QGD + P+ R+ S C +S+ +C GS E K +LD+ Sbjct: 17 QGDLESLPPQVREFIESNAKLCQPESIHICDGSEEENKKILDI 59
>DEOC_BDEBA (Q6MGR8) Deoxyribose-phosphate aldolase (EC 4.1.2.4)| (Phosphodeoxyriboaldolase) (Deoxyriboaldolase) (DERA) Length = 220 Score = 27.7 bits (60), Expect = 8.0 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = +1 Query: 31 LQPVKGNLKAKVKLANKETVKVIIQNS 111 L V+ ++KA V+ AN TVKVII+ S Sbjct: 102 LDYVRDDIKAVVQAANGHTVKVIIETS 128
>PAM17_CANGA (Q6FJJ0) Presequence translocated-associated motor subunit PAM17,| mitochondrial precursor Length = 186 Score = 27.7 bits (60), Expect = 8.0 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +1 Query: 43 KGNLKAKVKLANKETVKVIIQNSDSHSLQS 132 KGN A+ L NKE +K +IQN S QS Sbjct: 120 KGNKLAQYNLKNKEFLKHVIQNRVDASSQS 149 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,098,985 Number of Sequences: 219361 Number of extensions: 585370 Number of successful extensions: 1285 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1279 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1285 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)