| Clone Name | rbasd2g10 |
|---|---|
| Clone Library Name | barley_pub |
>PLMN_HUMAN (P00747) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Angiostatin; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 810 Score = 30.4 bits (67), Expect = 3.6 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = -2 Query: 189 GEVVTRFP*VNLRKDHCRDPDQN-RP-CSRHPILRRW 85 G + ++FP NL+K++CR+PD+ RP C +RW Sbjct: 218 GYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRW 254
>PLMN_MACMU (P12545) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 810 Score = 30.0 bits (66), Expect = 4.8 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 2/37 (5%) Frame = -2 Query: 189 GEVVTRFP*VNLRKDHCRDPD-QNRP-CSRHPILRRW 85 G + ++FP NL+K++CR+PD + RP C +RW Sbjct: 218 GYIPSKFPNKNLKKNYCRNPDGEPRPWCFTTDPNKRW 254
>TRPG_CAEEL (Q93971) Transient receptor potential channel (Abnormal gonad| development protein 2) Length = 2032 Score = 30.0 bits (66), Expect = 4.8 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = +2 Query: 239 RTAPVAAIRTLHRTIQSVGATGGVYKGQGRSQRELMTRA 355 RTAP+ R HR +S TGGVY +G R L+ A Sbjct: 124 RTAPIKKTRK-HRRRRSGSFTGGVYPRKGHRNRSLLGHA 161
>GATA6_ARATH (Q6DBP8) GATA transcription factor 6 (AtGATA-6)| Length = 303 Score = 29.6 bits (65), Expect = 6.2 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = -3 Query: 128 TKTDRARVIQSSDDGIVRRSANSSTASTP--RSGGSGKRT 15 T+T + + S+ DGIVR+ + T TP R G SG +T Sbjct: 203 TRTVSSTLEASNSDGIVRKCTHCETTKTPQWREGPSGPKT 242
>GATA5_ARATH (Q8VZP4) GATA transcription factor 5 (AtGATA-5)| Length = 308 Score = 29.3 bits (64), Expect = 8.1 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = -3 Query: 131 LTKTDRARVIQSSDDGIVRRSANSSTASTP--RSGGSGKRT 15 +T T+ + + S DGIVR + T +TP R G SG +T Sbjct: 200 ITHTESSTLESSKSDGIVRICTHCETITTPQWRQGPSGPKT 240 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,016,835 Number of Sequences: 219361 Number of extensions: 1592198 Number of successful extensions: 3601 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3599 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)