| Clone Name | rbasd2g01 |
|---|---|
| Clone Library Name | barley_pub |
>EDN1_BOVIN (P17322) Endothelin-1 precursor (ET-1) (Preproendothelin-1) (PPET1)| Length = 202 Score = 31.2 bits (69), Expect = 0.62 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = +3 Query: 252 CKNEMQLKRRYTSNVINLKNKISTCVRPSKAHSNMYR--LVIYNRAH 386 C ++ + R T + + N I T R +K + +YR VIYNRAH Sbjct: 156 CLHQQLVAGRKTRRLEAISNSIKTSFRVAKLKAQLYRDKKVIYNRAH 202
>YMS4_YEAST (Q05131) Hypothetical 48.4 kDa protein in ARP9-IMP2 intergenic| region Length = 434 Score = 29.3 bits (64), Expect = 2.4 Identities = 20/71 (28%), Positives = 30/71 (42%) Frame = -2 Query: 364 SLYIFECAFDGRTHVLILFFKLITLLVYLLFSCISFLHYI**EVLHTLFGGV*RKWFILL 185 S ++ AF +HV I+F L +Y+ F+ +S+L R WFIL Sbjct: 251 STAFYQDAFTSVSHVCIIFLCFFNLGIYIFFTGLSYL--------------CARPWFILK 296 Query: 184 HNPSDKENGSS 152 P + G S Sbjct: 297 LFPHEPIEGKS 307
>MSH3_ARATH (O65607) DNA mismatch repair protein MSH3 (AtMsh3)| Length = 1081 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -3 Query: 213 ESEENGSSCCTTHQIKKMVHLAAQPI 136 E+ E G SC T H I M HL Q + Sbjct: 364 EAAEKGMSCLTVHTIMNMPHLTVQAL 389
>IL3RB_MOUSE (P26955) Cytokine receptor common beta chain precursor| (GM-CSF/IL-3/IL-5 receptor common beta-chain) (CD131 antigen) Length = 896 Score = 28.5 bits (62), Expect = 4.0 Identities = 20/50 (40%), Positives = 25/50 (50%) Frame = -2 Query: 322 VLILFFKLITLLVYLLFSCISFLHYI**EVLHTLFGGV*RKWFILLHNPS 173 VLIL F ++TLL+ L F C+S V T RKW + NPS Sbjct: 449 VLILVFLILTLLLILRFGCVS--------VYRTY-----RKWKEKIPNPS 485
>THIL_SALTY (P55881) Thiamine-monophosphate kinase (EC 2.7.4.16)| (Thiamine-phosphate kinase) Length = 325 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 Query: 118 ACILLSDGLCSKMNHFLYLMGCAAR 192 A I LSDGL S + H + GC AR Sbjct: 209 AAIDLSDGLISDLGHIVKASGCGAR 233
>HLYB_SERMA (P15321) Hemolysin activator protein precursor| Length = 557 Score = 28.1 bits (61), Expect = 5.3 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = +3 Query: 75 DRSRERSTSEWYAHCLYTFI*WVVQQDEPFSLSDGLCSKMNHFLQTPPNR 224 D ++ST W A T D PF LSD + N L+ P +R Sbjct: 230 DNYGQKSTGRWLARATATL-------DSPFGLSDFVSLNANSTLENPAHR 272
>PNS1_ASPFU (Q4WYG7) Protein pns1| Length = 537 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = -2 Query: 304 KLITLLVYLLFSCISFLHYI**EVLHTLFGGV*RKWFILLHNPSDKENGSS 152 ++I L+VY+ F+ F ++ +HT GV W+ +P+ GS+ Sbjct: 277 RVIGLVVYVTFAMYWFSEWLK-NTIHTTIAGVYGSWYFWSQSPNGMPRGST 326
>AMA1_PLAFG (P50490) Apical membrane antigen 1 precursor (Merozoite surface| antigen) Length = 622 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = -3 Query: 240 RRCCILYLEESEENGSSCCTTHQIKKMVHLAAQPIR*KYTSN 115 ++C ILY+ E NG C Q K+ +P + K N Sbjct: 245 KKCHILYIAAQENNGPRYCNKDQSKRNSMFCFRPAKDKLFEN 286
>RS5_PODCA (Q08364) 40S ribosomal protein S5| Length = 210 Score = 27.3 bits (59), Expect = 9.0 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 97 PLSGTLIACILLSDGLCSKMNHFLYLMGCAAR 192 PL G I+ I L+D + K NH +YL AAR Sbjct: 30 PLEGLNISDISLTDYIAVKDNHAVYLPHTAAR 61
>EXOC3_CAEEL (Q19262) Probable exocyst complex component 3 (Exocyst complex| component Sec6) Length = 796 Score = 27.3 bits (59), Expect = 9.0 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +3 Query: 276 RRYTSNVINLKNKISTCVRPSKAHSNMYRL 365 + +TSN+I + N + TC+ ++ + RL Sbjct: 492 QEFTSNIIAIANNLHTCIESTEKYKQQIRL 521
>HAS2_XENLA (O57427) Hyaluronan synthase 2 (EC 2.4.1.212) (Hyaluronate synthase| 2) (Hyaluronic acid synthase 2) (HA synthase 2) (xHAS2) Length = 551 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 257 FTLHLVGGVAYSIWRSLKK 201 FT+ L+GGV Y+IWR KK Sbjct: 485 FTI-LLGGVCYTIWRETKK 502 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,517,235 Number of Sequences: 219361 Number of extensions: 1018138 Number of successful extensions: 1974 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1907 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1974 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)