| Clone Name | rbasd2e12 |
|---|---|
| Clone Library Name | barley_pub |
>RNH2_SYNJA (Q2JW45) Ribonuclease HII (EC 3.1.26.4) (RNase HII)| Length = 221 Score = 32.7 bits (73), Expect = 0.94 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 2/101 (1%) Frame = +1 Query: 160 AFVSLPSLLSPTKFQTKTRRNACRQ--PPPRHHYCQSSPMQISGAAGIVRXXXXXXXXXX 333 A V LP+ L P + + C+Q PP R H+ + Q++ A GI Sbjct: 49 AAVILPAHLDP---EALSGVRDCKQLRPPQRAHWAERIA-QVALAVGI--GSASAAEIDQ 102 Query: 334 XDAERPALVAAERLLAQVHEGIHVVXQPLPAEGARTRSSAI 456 + + L+A +R LAQV E H++ LP +R +A+ Sbjct: 103 LNIRQATLLAMQRALAQVGEVEHILLDGLPLAELGSRQTAL 143
>DCBD2_RAT (Q91ZV2) Discoidin, CUB and LCCL domain-containing protein 2| precursor (Endothelial and smooth muscle cell-derived neuropilin-like protein) Length = 769 Score = 32.0 bits (71), Expect = 1.6 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Frame = -1 Query: 530 RASLPGGLFSPLSPSRSGHGRPCQLMALLLVRAPSAGR----GCXTT 402 RA LP + PL P R+ RP +L+ LLL+ P AG GC T Sbjct: 27 RAPLPSAGWCPLPPGRNSSSRP-RLLLLLLLLLPDAGAQKGDGCGHT 72
>MELB_KLEPN (Q02581) Melibiose carrier protein (Thiomethylgalactoside permease| II) (Melibiose permease) (Na+ (Li+)/melibiose symporter) (Melibiose transporter) Length = 471 Score = 31.2 bits (69), Expect = 2.7 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -2 Query: 616 R*RVHLRDPARREPEDDAHPERP 548 R ++HL D RR PE+D PERP Sbjct: 442 RIQIHLLDKYRRVPENDVEPERP 464
>DCBD2_MOUSE (Q91ZV3) Discoidin, CUB and LCCL domain-containing protein 2| precursor (Endothelial and smooth muscle cell-derived neuropilin-like protein) Length = 769 Score = 30.8 bits (68), Expect = 3.6 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = -1 Query: 530 RASLPGGLFSPLSPSRSGHGRPCQLMALLLVRAPSAGR---GCXTT 402 RA+LP PL P R+ RP L+ LLL+ + G+ GC T Sbjct: 27 RAALPSAGCCPLPPGRNSSSRPRLLLLLLLLLQDAGGQQGDGCGHT 72
>IL1AP_MACMU (P59822) Interleukin-1 receptor accessory protein precursor (IL-1| receptor accessory protein) (IL-1RAcP) Length = 570 Score = 30.0 bits (66), Expect = 6.1 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 10/52 (19%) Frame = -3 Query: 606 YTCVIQHGANPRTTHILRGQTVEV---PKGV-------PSRRPIFTIEPIEE 481 YTCV+ + N RT H+ R TV+V PK P+ ++ EP EE Sbjct: 210 YTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPNDHVVYEKEPGEE 261
>IL1AP_HUMAN (Q9NPH3) Interleukin-1 receptor accessory protein precursor (IL-1| receptor accessory protein) (IL-1RAcP) Length = 570 Score = 30.0 bits (66), Expect = 6.1 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 10/52 (19%) Frame = -3 Query: 606 YTCVIQHGANPRTTHILRGQTVEV---PKGV-------PSRRPIFTIEPIEE 481 YTCV+ + N RT H+ R TV+V PK P+ ++ EP EE Sbjct: 210 YTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPNDHVVYEKEPGEE 261
>IL1AP_RAT (Q63621) Interleukin-1 receptor accessory protein precursor (IL-1| receptor accessory protein) (IL-1RAcP) Length = 570 Score = 29.6 bits (65), Expect = 8.0 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 10/62 (16%) Frame = -3 Query: 636 FVHCDCEDEEYTCVIQHGANPRTTHILRGQTVEV---PKGV-------PSRRPIFTIEPI 487 F+ + YTCV+ + N R H+ R TV+V PK P+ R ++ EP Sbjct: 200 FIPLVSNNGNYTCVVTYLENGRLFHLTRTMTVKVVGSPKDAVPPHIYSPNDRVVYEKEPG 259 Query: 486 EE 481 EE Sbjct: 260 EE 261
>IL1AP_MOUSE (Q61730) Interleukin-1 receptor accessory protein precursor (IL-1| receptor accessory protein) (IL-1RAcP) Length = 570 Score = 29.6 bits (65), Expect = 8.0 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 10/62 (16%) Frame = -3 Query: 636 FVHCDCEDEEYTCVIQHGANPRTTHILRGQTVEV---PKGV-------PSRRPIFTIEPI 487 F+ + YTCV+ + N R H+ R TV+V PK P+ R ++ EP Sbjct: 200 FIPLVSNNGNYTCVVTYPENGRLFHLTRTVTVKVVGSPKDALPPQIYSPNDRVVYEKEPG 259 Query: 486 EE 481 EE Sbjct: 260 EE 261 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 97,552,521 Number of Sequences: 219361 Number of extensions: 2086654 Number of successful extensions: 6250 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 5950 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6247 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6029593548 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)