| Clone Name | rbasd1o14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYG_ARCFU (O29346) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine... | 32 | 0.73 | 2 | UVE1_SCHPO (Q10988) UV-damage endonuclease (EC 3.-.-.-) (UVDE) | 31 | 1.6 | 3 | OLF9_MOUSE (Q60885) Olfactory receptor 9 (Olfactory receptor 269... | 30 | 4.7 | 4 | GP144_HUMAN (Q7Z7M1) Probable G-protein coupled receptor 144 (G-... | 29 | 8.1 |
|---|
>SYG_ARCFU (O29346) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA| ligase) (GlyRS) Length = 570 Score = 32.3 bits (72), Expect = 0.73 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -3 Query: 323 RRGFIQLRQFVYFTDSFFFHAGSRQYDHFPIY 228 R+G I+LR+F FF H G +++ HF +Y Sbjct: 197 RQGVIRLREFNQAELEFFVHPGEKKHPHFSLY 228
>UVE1_SCHPO (Q10988) UV-damage endonuclease (EC 3.-.-.-) (UVDE)| Length = 599 Score = 31.2 bits (69), Expect = 1.6 Identities = 23/62 (37%), Positives = 30/62 (48%) Frame = +3 Query: 267 EEERIREVDKLT*LNESSPSSGLTPAVCSGFQTHSGN*TRGLRSLRDLTQHLTARADDSH 446 EEE + EVD+ + NESS S P V +T R S ++L + T DD H Sbjct: 174 EEEYVEEVDEKSLKNESS-SDEFEPVVPEQLETPISKRRRSRSSAKNLEKESTMNLDD-H 231 Query: 447 AP 452 AP Sbjct: 232 AP 233
>OLF9_MOUSE (Q60885) Olfactory receptor 9 (Olfactory receptor 269-3) (Odorant| receptor M25) Length = 312 Score = 29.6 bits (65), Expect = 4.7 Identities = 19/69 (27%), Positives = 27/69 (39%) Frame = -1 Query: 235 LYTSTIIAMLVVSVLSLCLAIYHLLCQASLHFHEKPLTPPHPSKPLFGYVTACLALLIAF 56 LYT+TI+ ++ + S C I C L+F LFG CL +A+ Sbjct: 72 LYTTTIVPRMLADLRSSCPTIPLASCFTQLYFF-----------ALFGIAECCLLTAMAY 120 Query: 55 XSCKCSCXP 29 C P Sbjct: 121 DRYAAICCP 129
>GP144_HUMAN (Q7Z7M1) Probable G-protein coupled receptor 144 (G-protein coupled| receptor PGR24) Length = 963 Score = 28.9 bits (63), Expect = 8.1 Identities = 14/40 (35%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = -1 Query: 145 HFHEKPLTPPHPSKPLFG---YVTACLALLIAFXSCKCSC 35 H + PL PPHP P G T C + S C C Sbjct: 594 HRAQSPLFPPHPPSPYTGGAWATTGCSVAALYLDSTACFC 633 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,947,917 Number of Sequences: 219361 Number of extensions: 1513496 Number of successful extensions: 3552 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3550 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)