| Clone Name | rbasd1n08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RBP1B_ARATH (Q8RWG8) Ran-binding protein 1 homolog b | 39 | 0.015 | 2 | RBP1C_ARATH (P92985) Ran-binding protein 1 homolog c | 38 | 0.025 | 3 | RBP1A_ARATH (Q9LMK7) Ran-binding protein 1 homolog a (Ran-bindin... | 37 | 0.032 | 4 | BGB_DROME (Q24040) Protein big brother | 30 | 4.0 | 5 | DFRA_SYNY3 (P73212) Putative dihydroflavonol-4-reductase (EC 1.1... | 29 | 8.8 | 6 | RIMM_LACJO (Q74IQ5) Probable 16S rRNA-processing protein rimM | 29 | 8.8 |
|---|
>RBP1B_ARATH (Q8RWG8) Ran-binding protein 1 homolog b| Length = 217 Score = 38.5 bits (88), Expect = 0.015 Identities = 21/40 (52%), Positives = 26/40 (65%) Frame = -2 Query: 587 ENCKKFKDLVDEIAESLAKDEDGESVEGSSAAGLLEKLSV 468 ENCK F E+AES ++E ES + S AGLLEKL+V Sbjct: 146 ENCKAFMQKFKEVAES--EEEKEESKDASDTAGLLEKLTV 183
>RBP1C_ARATH (P92985) Ran-binding protein 1 homolog c| Length = 219 Score = 37.7 bits (86), Expect = 0.025 Identities = 21/40 (52%), Positives = 25/40 (62%) Frame = -2 Query: 587 ENCKKFKDLVDEIAESLAKDEDGESVEGSSAAGLLEKLSV 468 ENCK F + EIAES + ES +G AAGL+E LSV Sbjct: 143 ENCKTFMEKFTEIAES--QQVGKESTQGDEAAGLIENLSV 180
>RBP1A_ARATH (Q9LMK7) Ran-binding protein 1 homolog a (Ran-binding protein| siRanBP) Length = 228 Score = 37.4 bits (85), Expect = 0.032 Identities = 20/40 (50%), Positives = 26/40 (65%) Frame = -2 Query: 587 ENCKKFKDLVDEIAESLAKDEDGESVEGSSAAGLLEKLSV 468 ENCK F E+AES ++E ES + + AGLLEKL+V Sbjct: 144 ENCKTFMQKFKEVAES--EEEKEESKDAADTAGLLEKLTV 181
>BGB_DROME (Q24040) Protein big brother| Length = 213 Score = 30.4 bits (67), Expect = 4.0 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 4/40 (10%) Frame = -2 Query: 197 HLSIYCYM*NICSQYRGWL----LDGVVLLLSRTRNVVHE 90 H+ Y M +C ++RGW+ LDGV L R +HE Sbjct: 120 HIKSYFIMNGVCVRFRGWIDLERLDGVGCLEYDERRAMHE 159
>DFRA_SYNY3 (P73212) Putative dihydroflavonol-4-reductase (EC 1.1.1.219) (DFR)| (Dihydrokaempferol 4-reductase) Length = 343 Score = 29.3 bits (64), Expect = 8.8 Identities = 25/82 (30%), Positives = 35/82 (42%) Frame = -1 Query: 447 KRSKGGIIQGDRNQSRDNPLRVVGRAAHIRTVLLSFCSVARVSLWVLPVDGSW*SLPMTY 268 +R K + +GDR + + G AH+ T+ V LW LP+T+ Sbjct: 227 QRGKTALTRGDRYILGHENISLQGILAHLSTITGLPAPKNTVPLW----------LPLTF 276 Query: 267 AENFETVRRCLEQSPSSPPLGV 202 A E V L +SPS P GV Sbjct: 277 AWVEEKVLAPLGRSPSVPMDGV 298
>RIMM_LACJO (Q74IQ5) Probable 16S rRNA-processing protein rimM| Length = 173 Score = 29.3 bits (64), Expect = 8.8 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +2 Query: 83 LNTHGLHFEFSTKARQHHPKANLDTASRYFTYNNK 187 L+ HGL E A P+ L T SR F NNK Sbjct: 11 LSPHGLKGEVKVNATTDFPEERLATGSRLFIKNNK 45 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,487,421 Number of Sequences: 219361 Number of extensions: 1455893 Number of successful extensions: 3781 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3778 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5101629520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)