| Clone Name | rbasd2c01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HBA1_ALDEL (P83131) Hemoglobin A alpha-1 subunit (Hemoglobin A a... | 28 | 7.6 | 2 | FAT2_DROME (Q9VW71) Putative fat-like cadherin-related tumor sup... | 28 | 7.6 |
|---|
>HBA1_ALDEL (P83131) Hemoglobin A alpha-1 subunit (Hemoglobin A alpha-1 chain)| Length = 141 Score = 28.5 bits (62), Expect = 7.6 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -3 Query: 137 HMFNLS*DRHNLQSCNLCFILAQG-HHPVL 51 H NL D N + NLCF++ G HHP + Sbjct: 87 HAQNLRVDPVNFKLLNLCFVVVSGTHHPTI 116
>FAT2_DROME (Q9VW71) Putative fat-like cadherin-related tumor suppressor homolog| precursor Length = 4705 Score = 28.5 bits (62), Expect = 7.6 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 307 DADVDDHGNDECKNVHRCLQLPAAARGICP 396 + DVD+ N C N C+ P + R ICP Sbjct: 4241 EIDVDECENQPCGNGATCINEPGSFRCICP 4270 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,366,491 Number of Sequences: 219361 Number of extensions: 1067697 Number of successful extensions: 2709 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2708 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)