ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbasd1k09 |
|---|---|
| Clone Library Name | barley_pub |
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 34.3 bits (77), Expect = 0.32 Identities = 20/50 (40%), Positives = 24/50 (48%) Frame = -3 Query: 533 PELRRTPPAPGTGPLNRLYPARWRRAPSEPPPHRPCRESFVPDELNPCIP 384 P RR P+P PAR RR+PS PPP R R +P +P P Sbjct: 537 PRRRRRSPSPP--------PARRRRSPSPPPPPRRRRSPSLPRRRSPSPP 578
>GMHA_STRCO (Q9Z5B6) Phosphoheptose isomerase (EC 5.3.1.-) (Sedoheptulose| 7-phosphate isomerase) Length = 231 Score = 32.7 bits (73), Expect = 0.93 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = -1 Query: 556 HGAQARGYRSFVGRLQHPERAPSTGYTQPAGEEPRRSR 443 HGA+A G + GR ERA STG AG +R R Sbjct: 193 HGARAAGSAASTGRAARRERAASTGRAAGAGRAAQRKR 230
>DP2L_METTH (O27579) DNA polymerase II large subunit (EC 2.7.7.7) (Pol II)| Length = 1092 Score = 32.7 bits (73), Expect = 0.93 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -3 Query: 566 IPMSWCPSSWLPELRRTPPAPGTGPLN-RLYPARW 465 +P WC W+ + +P PG PLN Y RW Sbjct: 416 MPAGWCEEWWIQTILSSPKYPGDDPLNLSYYRTRW 450
>PROL1_HUMAN (Q99935) Proline-rich protein 1 precursor (PRL1) (Basic| proline-rich lacrimal protein) Length = 201 Score = 31.2 bits (69), Expect = 2.7 Identities = 26/78 (33%), Positives = 31/78 (39%), Gaps = 5/78 (6%) Frame = -3 Query: 611 SFALKLLSVFPCFCSIPMSWCPSSWLPELRRTPPAPGTGPLNRLYPARWRRAPSEPPPH- 435 +F L LL++ CF S R P PG P LY RW PS PPP+ Sbjct: 4 TFFLGLLALISCFTP--------SESQRFSRRPYLPGQLPPPPLYRPRW-VPPSPPPPYD 54 Query: 434 ----RPCRESFVPDELNP 393 P FVP + P Sbjct: 55 SRLNSPLSLPFVPGRVPP 72
>EXPA_DROME (Q07436) Protein expanded| Length = 1427 Score = 31.2 bits (69), Expect = 2.7 Identities = 18/51 (35%), Positives = 25/51 (49%) Frame = -3 Query: 536 LPELRRTPPAPGTGPLNRLYPARWRRAPSEPPPHRPCRESFVPDELNPCIP 384 LP+ +R PP P +NR APSE PP P + +P ++P P Sbjct: 1192 LPKGKRLPPPPPPPYVNRRLKKPPMPAPSEKPPPIPSKP--IPSRMSPIPP 1240
>CD2L7_HUMAN (Q9NYV4) Cell division cycle 2-related protein kinase 7 (EC| 2.7.11.22) (CDC2-related protein kinase 7) (Cdc2-related kinase, arginine/serine-rich) (CrkRS) Length = 1490 Score = 30.8 bits (68), Expect = 3.5 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -3 Query: 551 CPSSWLPELRRTPPAPGTGPLNRLYPARWRRAPSEPPPHRPCRESFVPDELNPCI 387 CP LP +R P PG P P PPP S P ELNP + Sbjct: 1255 CPPHILPPEKRPPEPPGPPP------------PPPPPPLVEGDLSSAPQELNPAV 1297
>VGLB_HHV1F (P06436) Glycoprotein B precursor| Length = 903 Score = 30.4 bits (67), Expect = 4.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 515 PPAPGTGPLNRLYPARWRRAPSEPPPHRPCRES 417 PPAPG P P + + P PPP RP ++ Sbjct: 55 PPAPGPAPTGDTKPKK-NKKPKNPPPPRPAGDN 86
>WASF1_MOUSE (Q8R5H6) Wiskott-Aldrich syndrome protein family member 1| (WASP-family protein member 1) (WAVE-1 protein) Length = 559 Score = 30.4 bits (67), Expect = 4.6 Identities = 21/64 (32%), Positives = 29/64 (45%) Frame = -3 Query: 566 IPMSWCPSSWLPELRRTPPAPGTGPLNRLYPARWRRAPSEPPPHRPCRESFVPDELNPCI 387 +P + SS + TPP P P PA +AP+ PPP P + P L+P Sbjct: 331 LPSALSTSSLRASMTSTPPPPVPPPPPP--PATALQAPAVPPPPAPLQ--IAPGVLHPAP 386 Query: 386 PDLA 375 P +A Sbjct: 387 PPIA 390
>WASF1_HUMAN (Q92558) Wiskott-Aldrich syndrome protein family member 1| (WASP-family protein member 1) (WAVE-1 protein) (Verprolin homology domain-containing protein 1) Length = 559 Score = 30.4 bits (67), Expect = 4.6 Identities = 21/64 (32%), Positives = 29/64 (45%) Frame = -3 Query: 566 IPMSWCPSSWLPELRRTPPAPGTGPLNRLYPARWRRAPSEPPPHRPCRESFVPDELNPCI 387 +P + SS + TPP P P PA +AP+ PPP P + P L+P Sbjct: 331 LPSALSTSSLRASMTSTPPPPVPPPPPP--PATALQAPAVPPPPAPLQ--IAPGVLHPAP 386 Query: 386 PDLA 375 P +A Sbjct: 387 PPIA 390
>FP1_MYTGA (Q27409) Adhesive plaque matrix protein precursor (Foot protein 1)| (MGFP1) (MGFP-1) Length = 751 Score = 30.4 bits (67), Expect = 4.6 Identities = 22/82 (26%), Positives = 35/82 (42%), Gaps = 6/82 (7%) Frame = -3 Query: 635 PFYRPS-SFSFALKLLSVFPCFCSIPMSWCPS-----SWLPELRRTPPAPGTGPLNRLYP 474 P Y+P S+ K +P S+ P+ S+LP + P P T YP Sbjct: 357 PSYKPKISYPPTYKAKPSYPPIYKAKPSYPPTYKAKPSYLPTYKAKPSYPPTYKAKPRYP 416 Query: 473 ARWRRAPSEPPPHRPCRESFVP 408 ++ PS PP ++ + S+ P Sbjct: 417 TTYKAKPSYPPTYK-AKPSYPP 437
>PSAD_HORVU (P36213) Photosystem I reaction center subunit II, chloroplast| precursor (Photosystem I 20 kDa subunit) (PSI-D) Length = 205 Score = 30.4 bits (67), Expect = 4.6 Identities = 19/61 (31%), Positives = 25/61 (40%) Frame = -3 Query: 566 IPMSWCPSSWLPELRRTPPAPGTGPLNRLYPARWRRAPSEPPPHRPCRESFVPDELNPCI 387 I +W PS+ P+ GP A AP+ PP P FVP +L+P Sbjct: 15 ITAAWSPSAKPRPATLAMPSSARGPAPLFAAAPDTPAPAAPPAE-PAPAGFVPPQLDPST 73 Query: 386 P 384 P Sbjct: 74 P 74
>SPRR4_MOUSE (Q8CGN8) Small proline-rich protein 4| Length = 76 Score = 30.0 bits (66), Expect = 6.0 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 461 RAPSEPPPHRPCRESFVPDELNPCIP 384 + P +PPP + C+E+ VP +PC+P Sbjct: 22 KQPCQPPPTK-CQEACVPKTKDPCVP 46
>WRK10_ARATH (Q9LG05) Probable WRKY transcription factor 10 (WRKY DNA-binding| protein 10) Length = 506 Score = 30.0 bits (66), Expect = 6.0 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = -3 Query: 473 ARWRRAPSEPPPHRPCRESFVPDELNPCIPDLATETSL 360 +R RAP P P P S+ P+E+ P LATE L Sbjct: 414 SRLGRAPPTPTPPTPPPSSYTPEEMRP-FSSLATEIDL 450
>KCNH2_CANFA (Q9TSZ3) Potassium voltage-gated channel subfamily H member 2| (Voltage-gated potassium channel subunit Kv11.1) (Ether-a-go-go-related gene potassium channel 1) (ERG1) (c-erg) (DERG) (Ether-a-go-go-related protein 1) (Eag-related protein 1) Length = 1158 Score = 30.0 bits (66), Expect = 6.0 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 3/69 (4%) Frame = -3 Query: 512 PAPGTGPLNRLYPARWRRAPSEPPPHRPCRE--SFVPDELNPCIPDLATETSLFVFSVWS 339 P + PL RL P R P EPP P E D NP + ++ +FS W Sbjct: 945 PGRSSSPL-RLVPFSSPRPPGEPPGGEPLTEDGEKSSDTCNPLSGAFSGVSN--IFSFWG 1001 Query: 338 DSR-HEFRK 315 DSR H++++ Sbjct: 1002 DSRGHQYQE 1010
>SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1| (Plenty-of-prolines 101) Length = 946 Score = 29.6 bits (65), Expect = 7.9 Identities = 20/54 (37%), Positives = 24/54 (44%), Gaps = 5/54 (9%) Frame = -3 Query: 533 PELRRTPPAPGTGPLNRLYPARWRRAPSEPPPHR-----PCRESFVPDELNPCI 387 P RR P+P P P R RR+P+ PP R P R S P +P I Sbjct: 566 PARRRRSPSPAPPPPPPPPPPRRRRSPTPPPRRRTPSPPPRRRSPSPRRYSPPI 619
>TNF18_HUMAN (Q9UNG2) Tumor necrosis factor ligand superfamily member 18| (Glucocorticoid-induced TNF-related ligand) (hGITRL) (Activation-inducible TNF-related ligand) (AITRL) Length = 177 Score = 29.6 bits (65), Expect = 7.9 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 8/53 (15%) Frame = -3 Query: 575 FCSIPMSW--CPSSWLP------ELRRTPPAPGTGPLNRLYPARWRRAPSEPP 441 FCSI M C SWL E + P GPL P++W+ A SEPP Sbjct: 29 FCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPL----PSKWQMASSEPP 77
>FA5_PIG (Q9GLP1) Coagulation factor V precursor (Activated protein C| cofactor) [Contains: Coagulation factor V heavy chain; Coagulation factor V light chain] Length = 2258 Score = 29.6 bits (65), Expect = 7.9 Identities = 17/50 (34%), Positives = 22/50 (44%) Frame = -3 Query: 536 LPELRRTPPAPGTGPLNRLYPARWRRAPSEPPPHRPCRESFVPDELNPCI 387 LPE +T P P G + PS PP H +F+P E NP + Sbjct: 1512 LPEFGQTSPFPDLG-----------QRPS-PPSHSTLNNTFIPREFNPMV 1549 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,955,994 Number of Sequences: 219361 Number of extensions: 1618959 Number of successful extensions: 5987 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 5282 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5923 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
