| Clone Name | rbasd1i01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | WFDC9_RAT (Q6IE41) Protein WFDC9 precursor | 30 | 2.9 | 2 | P53_RABIT (Q95330) Cellular tumor antigen p53 (Tumor suppressor ... | 28 | 8.6 | 3 | SREC_HUMAN (Q14162) Endothelial cells scavenger receptor precurs... | 28 | 8.6 |
|---|
>WFDC9_RAT (Q6IE41) Protein WFDC9 precursor| Length = 74 Score = 29.6 bits (65), Expect = 2.9 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = +3 Query: 48 HKIAYFLYLFALLPQIKARNEQILHHQTCKYHILGNLLRRIQN--QPNWACCWCCC 209 H I FL++F L + EQ ++ G ++Q PN+ CCW C Sbjct: 13 HGIVVFLHVFGSLKEKPEEIEQCWVQPPARF--CGRRCTKVQKCVSPNYTCCWTYC 66
>P53_RABIT (Q95330) Cellular tumor antigen p53 (Tumor suppressor p53)| Length = 391 Score = 28.1 bits (61), Expect = 8.6 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +1 Query: 34 FSHADTKLHISCIYLPCYHKLRQEMNRFCIIK 129 F H+ T ++C Y PC +KL ++ + C ++ Sbjct: 110 FLHSGTAKSVTCTYSPCLNKLFCQLAKTCPVQ 141
>SREC_HUMAN (Q14162) Endothelial cells scavenger receptor precursor (Acetyl LDL| receptor) (Scavenger receptor class F member 1) Length = 830 Score = 28.1 bits (61), Expect = 8.6 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +3 Query: 144 ILGNLLRRIQNQPNWACCWCCCWI-RSD 224 I+G+L+ + ACC CCCW RSD Sbjct: 424 IVGSLVPLLLLFLGLACCACCCWAPRSD 451 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,094,530 Number of Sequences: 219361 Number of extensions: 687162 Number of successful extensions: 1691 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1652 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1685 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)