| Clone Name | rbasd1g21 |
|---|---|
| Clone Library Name | barley_pub |
>AIRE_MOUSE (Q9Z0E3) Autoimmune regulator (Autoimmune polyendocrinopathy| candidiasis ectodermal dystrophy protein homolog) (APECED protein homolog) Length = 552 Score = 31.2 bits (69), Expect = 0.64 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = -1 Query: 356 VRSSPCEVRLKFREEQK-GQXSGDQGLLHLPRAIRLSLKRQDRPRAEEAEYXS*CSVCAD 180 VR+ +V + R+EQK GQ G L LP +++ K +D C+VC D Sbjct: 258 VRAKGAQVTIPGRDEQKVGQQCGVPPLPSLPSEPQVNQKNEDE-----------CAVCHD 306 Query: 179 GGQ 171 GG+ Sbjct: 307 GGE 309
>HXA7_MORSA (Q9PWD4) Homeobox protein Hox-A7| Length = 225 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 105 YWQGASRATLSCSLRNQARILCDTC 31 Y QG TL CSL +Q+R+ D+C Sbjct: 73 YGQGQDAHTLHCSLFDQSRLFTDSC 97
>EXO1_XENLA (Q9W6K2) Exonuclease 1 (EC 3.1.-.-) (Exonuclease I)| Length = 734 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -2 Query: 298 RAAIKASSIFPEPSGSASKGKIDLALKRRNI 206 +A+ S FPEP GSA K K+ LK +++ Sbjct: 652 KASPAHQSFFPEPKGSAPKSKVPGLLKSQSV 682
>KPCD1_MOUSE (Q62101) Serine/threonine-protein kinase D1 (EC 2.7.11.13)| (nPKC-D1) (Protein kinase D) (Protein kinase C mu type) (nPKC-mu) Length = 918 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -1 Query: 302 QXSGDQGLLHLPRAIRLSLKRQDRPRAEEAE 210 Q +G+QGL + I LS D P AEE E Sbjct: 877 QYAGEQGLQYPAHLISLSASHSDSPEAEERE 907
>RECQ1_CAEEL (P46064) Putative ATP-dependent DNA helicase Q1 (EC 3.6.1.-)| Length = 892 Score = 28.1 bits (61), Expect = 5.5 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -3 Query: 78 LSCSLRNQARILCDTCTSHAAL 13 L+C +RNQ++ + DT T H +L Sbjct: 347 LACKIRNQSKTIMDTITRHPSL 368
>Y855_MYCLE (O32965) Hypothetical zinc protease ML0855 (EC 3.4.99.-)| Length = 445 Score = 27.7 bits (60), Expect = 7.1 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 16 SSMTGTGITKYSCLIAQGTTQGG 84 +S+ G GIT+ C IA+G+ +GG Sbjct: 345 ASVAGDGITEAECRIAKGSLRGG 367 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,186,857 Number of Sequences: 219361 Number of extensions: 569077 Number of successful extensions: 1449 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1419 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1449 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)