| Clone Name | rbasd1g10 |
|---|---|
| Clone Library Name | barley_pub |
>FZD8_HUMAN (Q9H461) Frizzled 8 precursor (Frizzled-8) (Fz-8) (hFz8)| Length = 694 Score = 29.6 bits (65), Expect = 3.3 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 394 PGKQPPXDETHGSHPGDGTPPHK 326 PG+QPP HG PG PPH+ Sbjct: 172 PGEQPPSGSGHGRPPG-ARPPHR 193
>FZD8_MOUSE (Q61091) Frizzled 8 precursor (Frizzled-8) (Fz-8) (mFz8)| Length = 685 Score = 28.9 bits (63), Expect = 5.7 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -1 Query: 412 LPTXHRPGKQPPXDETHGSHPGDGTPPHK 326 LP PG+QPP H PG PPH+ Sbjct: 167 LPPPPPPGEQPPSGSGHSRPPG-ARPPHR 194
>RGMC_RAT (Q8N7M5) Hemojuvelin precursor (Hemochromatosis type 2 protein| homolog) (RGM domain family member C) Length = 422 Score = 28.1 bits (61), Expect = 9.7 Identities = 12/22 (54%), Positives = 17/22 (77%), Gaps = 2/22 (9%) Frame = +1 Query: 244 GPPSSPSKCLIRIFT--FVLFF 303 GPP SP+ CL+R+ + FVL+F Sbjct: 398 GPPLSPATCLVRLLSVLFVLWF 419
>CASR_HUMAN (P41180) Extracellular calcium-sensing receptor precursor (CaSR)| (Parathyroid Cell calcium-sensing receptor) Length = 1078 Score = 28.1 bits (61), Expect = 9.7 Identities = 18/64 (28%), Positives = 26/64 (40%) Frame = -3 Query: 194 TF*AAGCC*VWLLQTPPSMYRE*RISAT*LPEDLRQMSQALLYTCERNAVKLLCFIFILY 15 TF C +WL PPS YR + + + TC ++ L F+ I Y Sbjct: 732 TFMQIVICVIWLYTAPPSSYRNQELE-----------DEIIFITCHEGSLMALGFL-IGY 779 Query: 14 RCLM 3 CL+ Sbjct: 780 TCLL 783
>POLR_OYMV (P20127) RNA replicase polyprotein (EC 2.7.7.48)| Length = 1776 Score = 28.1 bits (61), Expect = 9.7 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = -2 Query: 231 SPFQRERGTQTFHILSSR--VLLSLAPSNPSFHVQRVTH*CYLTTGRPETDVPSPP 70 SPF +TFH+ S + LSL P +PS + + P + PSPP Sbjct: 513 SPFNLSWSLETFHVQSPSPFLPLSLTPPSPSEEIALPPPIFRVPPPLPAQETPSPP 568
>EXP24_ARATH (Q9FL76) Alpha-expansin 24 precursor (AtEXPA24) (At-EXP24) (AtEx24)| (Ath-ExpAlpha-1.19) Length = 312 Score = 28.1 bits (61), Expect = 9.7 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 400 HRPGKQPPXDETHGSHPGDGTPP 332 H PG +P +HG+HP G P Sbjct: 33 HVPGGRPGAHPSHGAHPAHGAHP 55 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,839,245 Number of Sequences: 219361 Number of extensions: 1330891 Number of successful extensions: 3229 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3052 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3227 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)