| Clone Name | rbasd1g07 |
|---|---|
| Clone Library Name | barley_pub |
>TRK2_YEAST (P28584) Low-affinity potassium transport protein| Length = 889 Score = 29.6 bits (65), Expect = 2.1 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -2 Query: 111 IQTFEFGIGVLMQVVXSPWXCMRHQYGSVV 22 + + G +L V PW C RH Y ++ Sbjct: 466 LMVYYIGFNILAFVTIVPWACTRHHYSEII 495
>USH2A_MOUSE (Q2QI47) Usherin precursor (Usher syndrome type-2A protein homolog)| (Usher syndrome type IIa protein homolog) Length = 5193 Score = 28.9 bits (63), Expect = 3.5 Identities = 20/67 (29%), Positives = 25/67 (37%) Frame = +2 Query: 44 RIQXHGEXTTCINTPMPNSNVWM*KSIKHXTPHTTTSNANVFRCEDTKYLYDNFQASVSD 223 R Q HG TC T P + +PH+ T RC LY++ D Sbjct: 514 RCQCHGHAETCDRTRRPYRCLC--------SPHSFTEGPQCDRCSP---LYNDKPFRSGD 562 Query: 224 NTRAFEC 244 N AF C Sbjct: 563 NVNAFNC 569
>POLG_PVYO (P22602) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3] (Fragment) Length = 856 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -3 Query: 248 GNTQMPVCCRTLKPGSCHISTWYLHI*RHL 159 GN P CC TL GS ST+Y +HL Sbjct: 568 GNYVYPCCCTTLDDGSAIESTFYPPTKKHL 597
>POLG_PVYN (P18247) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3; 6 kDa protein 1 (6K1); Cytoplasmic inclusion protein (EC 3.6.1.-) (CI); 6 kDa protein 2 (6K2); Viral gen Length = 3063 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -3 Query: 248 GNTQMPVCCRTLKPGSCHISTWYLHI*RHL 159 GN P CC TL GS ST+Y +HL Sbjct: 568 GNYVYPCCCTTLDDGSAIESTFYPPTKKHL 597
>POLG_PVYC (P22601) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3] (Fragment) Length = 856 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -3 Query: 248 GNTQMPVCCRTLKPGSCHISTWYLHI*RHL 159 GN P CC TL GS ST+Y +HL Sbjct: 568 GNYVYPCCCTTLDDGSAIESTFYPPTKKHL 597
>POLG_PVYHU (Q02963) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3; 6 kDa protein 1 (6K1); Cytoplasmic inclusion protein (EC 3.6.1.-) (CI); 6 kDa protein 2 (6K2); Viral ge Length = 3061 Score = 28.5 bits (62), Expect = 4.6 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -3 Query: 248 GNTQMPVCCRTLKPGSCHISTWYLHI*RHL 159 GN P CC TL GS ST+Y +HL Sbjct: 568 GNYVYPCCCTTLDDGSAVESTFYPPTKKHL 597
>YNS5_CAEEL (Q22288) Hypothetical UPF0205 protein T07C4.5 precursor| Length = 130 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 54 TMVKXQLASTHRCQIQMSGCKRAS 125 T + L TH C ++ +GCKR S Sbjct: 76 TSISPYLIITHNCNVKKAGCKRVS 99 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,689,148 Number of Sequences: 219361 Number of extensions: 659150 Number of successful extensions: 1299 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1298 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)