| Clone Name | rbasd1f07 |
|---|---|
| Clone Library Name | barley_pub |
>ADA32_HUMAN (Q8TC27) ADAM 32 precursor (A disintegrin and metalloprotease| domain 32) Length = 787 Score = 31.6 bits (70), Expect = 0.57 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -3 Query: 98 C*QERIL-GICYARSSGCSWHQSCASQNKCHCA 3 C + RI+ + S CS H C S+NKCHC+ Sbjct: 613 CVESRIIKASAHVCSQQCSGHGVCDSRNKCHCS 645
>COAT_GMDNV (Q90125) Coat protein VP1 (Structural protein VP1) [Contains: Coat| protein VP (Structural protein VP2); Coat protein VP3 (Structural protein VP3); Coat protein VP4 (Structural protein VP4)] Length = 811 Score = 30.0 bits (66), Expect = 1.7 Identities = 19/43 (44%), Positives = 24/43 (55%) Frame = +3 Query: 6 TMALILTGTALMPGTSTGPGITNAQNPFLSATG*SNFGFPSST 134 TMA+ L GT GTS+G G T Q+ ++ SNFG ST Sbjct: 372 TMAMSLPGTG--SGTSSGGGNTQGQDVYIIPRPFSNFGKKLST 412
>WRK74_ARATH (Q93WU6) Probable WRKY transcription factor 74 (WRKY DNA-binding| protein 74) Length = 330 Score = 28.9 bits (63), Expect = 3.7 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -3 Query: 68 YARSSGCSWHQSCASQNKCHCA 3 ++R + CS C S++KCHC+ Sbjct: 216 HSRRTSCSGSLKCGSKSKCHCS 237
>AWH_DROME (Q8IRC7) LIM/homeobox protein Awh (Protein arrowhead)| Length = 275 Score = 28.5 bits (62), Expect = 4.9 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = -3 Query: 122 KTEI*SAGC*QERILGICYARSSGCSWHQSCASQNKCHC 6 KTE+ S E I + GCSWH C C C Sbjct: 2 KTELRSCAACGEPISDRFFLEVGGCSWHAHCLRCCMCMC 40
>COAT_JCDNV (Q90053) Coat protein VP1 (Structural protein VP1) [Contains: Coat| protein VP (Structural protein VP2); Coat protein VP3 (Structural protein VP3); Coat protein VP4 (Structural protein VP4)] Length = 810 Score = 27.7 bits (60), Expect = 8.3 Identities = 18/42 (42%), Positives = 23/42 (54%) Frame = +3 Query: 9 MALILTGTALMPGTSTGPGITNAQNPFLSATG*SNFGFPSST 134 MA+ L GT GTS+G G T+ Q ++ SNFG ST Sbjct: 372 MAMSLPGTG--SGTSSGGGNTSGQEVYVIPRPFSNFGKKLST 411 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,979,419 Number of Sequences: 219361 Number of extensions: 541230 Number of successful extensions: 1659 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1658 length of database: 80,573,946 effective HSP length: 54 effective length of database: 68,728,452 effective search space used: 1649482848 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)