| Clone Name | rbasd1e09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PUB14_ARATH (Q8VZ40) E3 ubiquitin ligase PUB14 (EC 6.3.2.-) (Pro... | 45 | 2e-04 | 2 | SPL11_ORYSA (Q64HA9) Spotted leaf protein 11 (Spotted leaf11) (C... | 40 | 0.006 | 3 | OR33B_DROME (P81915) Odorant receptor 33b | 32 | 1.3 | 4 | DCPS_YEAST (Q06151) Scavenger mRNA decapping enzyme DcpS (EC 3.-... | 31 | 2.8 | 5 | KLC2_MOUSE (O88448) Kinesin light chain 2 (KLC 2) | 30 | 6.3 |
|---|
>PUB14_ARATH (Q8VZ40) E3 ubiquitin ligase PUB14 (EC 6.3.2.-) (Prototypical U-box| domain protein 14) Length = 632 Score = 44.7 bits (104), Expect = 2e-04 Identities = 23/74 (31%), Positives = 46/74 (62%) Frame = -1 Query: 598 ISSLVGLMRRGTPKGKENAVSALYEICRRGGSTLVRRVAKIPGLNTVIQNIMLTGTKRAK 419 I LV ++R G+P+ +ENA + L+ +C G+ VA+ G + ++ + GT RAK Sbjct: 553 IPVLVEIIRTGSPRNRENAAAILWYLCI--GNIERLNVAREVGADVALKELTENGTDRAK 610 Query: 418 KKASLIVKMCQRSQ 377 +KA+ ++++ Q+++ Sbjct: 611 RKAASLLELIQQTE 624
>SPL11_ORYSA (Q64HA9) Spotted leaf protein 11 (Spotted leaf11) (Cell| death-related protein SPL11) Length = 694 Score = 40.0 bits (92), Expect = 0.006 Identities = 24/91 (26%), Positives = 46/91 (50%) Frame = -1 Query: 655 ALLMKQPSVVHHVGSSETVISSLVGLMRRGTPKGKENAVSALYEICRRGGSTLVRRVAKI 476 ++L P +G++E V LV ++ GTP+ +ENA + + +C + A+ Sbjct: 557 SILSSHPEGKAAIGAAEPV-PVLVEMIGSGTPRNRENAAAVMLHLCSGEHHLVHLARAQE 615 Query: 475 PGLNTVIQNIMLTGTKRAKKKASLIVKMCQR 383 G+ ++ + L GT R K+KA +++ R Sbjct: 616 CGIMVPLRELALNGTDRGKRKAVQLLERMSR 646
>OR33B_DROME (P81915) Odorant receptor 33b| Length = 379 Score = 32.3 bits (72), Expect = 1.3 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +3 Query: 360 DIADGIWLLWHILTIKLAFFLARFVPVSMMFCITVFNP 473 DI WL WH+L ++ FFL R + + + +T++ P Sbjct: 12 DIYRTYWLYWHLLGLESNFFLNRLLDLVITIFVTIWYP 49
>DCPS_YEAST (Q06151) Scavenger mRNA decapping enzyme DcpS (EC 3.-.-.-) (DCS-1)| (Hint-related 7meGMP-directed hydrolase 1) Length = 350 Score = 31.2 bits (69), Expect = 2.8 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 2/70 (2%) Frame = -3 Query: 569 GNSKGQGECSVRSIRDMSSWWLNIGAESSKDSGVEYCNTEHHAHWNKARQEE--SKLDRQ 396 GNS G+ + + D+ +G E + + Y E+H W + +EE +L+R Sbjct: 280 GNSIAAGKAIL--LEDIIEMLNYLGPEGYMNKTITYAIGENHDLWKRGLEEELTKQLERD 337 Query: 395 DVPKKPNAVS 366 +PK P V+ Sbjct: 338 GIPKIPKIVN 347
>KLC2_MOUSE (O88448) Kinesin light chain 2 (KLC 2)| Length = 599 Score = 30.0 bits (66), Expect = 6.3 Identities = 32/109 (29%), Positives = 46/109 (42%) Frame = -1 Query: 610 SETVISSLVGLMRRGTPKGKENAVSALYEICRRGGSTLVRRVAKIPGLNTVIQNIMLTGT 431 S TV ++L L P+GK A L + R R+ P T + ++ G+ Sbjct: 443 SPTVNTTLRTLGALYRPEGKLEAAHTLEDCASRS-----RKQGLDPASQTKVVELLKDGS 497 Query: 430 KRAKKKASLIVKMCQRSQMPSAMSLGTSLRAVDHSLVGNSSLRRAASFG 284 R ++ S V Q S L S A + S G+ SLRR+ SFG Sbjct: 498 GRGHRRGSRDVAGPQ-----SESDLEESGPAAEWSGDGSGSLRRSGSFG 541 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,968,426 Number of Sequences: 219361 Number of extensions: 1956923 Number of successful extensions: 4742 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4742 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6200242422 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)