| Clone Name | rbasd1d20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YHE1_YEAST (P38730) Hypothetical 17.6 kDa protein in CBP2 5'region | 30 | 1.9 | 2 | ADAS_DICDI (O96759) Alkyldihydroxyacetonephosphate synthase (EC ... | 27 | 9.2 |
|---|
>YHE1_YEAST (P38730) Hypothetical 17.6 kDa protein in CBP2 5'region| Length = 149 Score = 29.6 bits (65), Expect = 1.9 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 142 NVSSKTPXMXVLYHLPLSSKECNWLSVSFIRQQFVQHLE 258 +V K P +L+H PL SK N L +SF+ Q+ + E Sbjct: 83 SVLEKLPQNILLFHYPLPSKMGNNLLMSFLTQRSIDEKE 121
>ADAS_DICDI (O96759) Alkyldihydroxyacetonephosphate synthase (EC 2.5.1.26)| (Alkyl-DHAP synthase) (Alkylglycerone-phosphate synthase) Length = 611 Score = 27.3 bits (59), Expect = 9.2 Identities = 16/80 (20%), Positives = 33/80 (41%) Frame = +1 Query: 112 NQGXPKGXSRNVSSKTPXMXVLYHLPLSSKECNWLSVSFIRQQFVQHLEGSTMMS*MVPA 291 +QG P ++S LY + S + N + Q++E +M+ ++ Sbjct: 486 DQGIPAWICAHISHTYTNGVCLYFIFASKQNEN--------KDMAQYIEAKKLMTDIIFK 537 Query: 292 VTRKIRHHYDCEYDHCGWLS 351 + HH+ Y+H W++ Sbjct: 538 YGGSLSHHHGVGYEHVPWMT 557 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,149,629 Number of Sequences: 219361 Number of extensions: 757955 Number of successful extensions: 1377 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1361 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1377 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)