| Clone Name | rbasd1d08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | APC_RAT (P70478) Adenomatous polyposis coli protein (Protein APC) | 33 | 0.65 | 2 | APC_MOUSE (Q61315) Adenomatous polyposis coli protein (Protein A... | 33 | 0.85 | 3 | MUTL_VIBF1 (Q5E2C6) DNA mismatch repair protein mutL | 30 | 7.2 | 4 | UPPS_HELPY (P55984) Undecaprenyl pyrophosphate synthetase (EC 2.... | 30 | 7.2 | 5 | UPPS_HELPJ (Q9ZK05) Undecaprenyl pyrophosphate synthetase (EC 2.... | 30 | 7.2 |
|---|
>APC_RAT (P70478) Adenomatous polyposis coli protein (Protein APC)| Length = 2842 Score = 33.5 bits (75), Expect = 0.65 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Frame = -3 Query: 442 ASVHYAIRSACCAPRNPTSESWGIPSLKVGSSCGNSSHRSEDLRKDRPSEFGAP----PS 275 +S+H A +A C R +S+S I SLK G S G+ H + D + + P P Sbjct: 2112 SSLHQAAAAAACLSRQASSDSDSILSLKSGVSLGSPFHLTPDQEEKPFTSHKGPRILKPG 2171 Query: 274 RAFNIEAK 251 +EAK Sbjct: 2172 EKSTLEAK 2179
>APC_MOUSE (Q61315) Adenomatous polyposis coli protein (Protein APC) (mAPC)| Length = 2845 Score = 33.1 bits (74), Expect = 0.85 Identities = 18/48 (37%), Positives = 29/48 (60%) Frame = -3 Query: 442 ASVHYAIRSACCAPRNPTSESWGIPSLKVGSSCGNSSHRSEDLRKDRP 299 +S+H A +A C R +S+S I SLK G S G+ H + D ++++P Sbjct: 2112 SSLHQAAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPD-QEEKP 2158
>MUTL_VIBF1 (Q5E2C6) DNA mismatch repair protein mutL| Length = 660 Score = 30.0 bits (66), Expect = 7.2 Identities = 19/59 (32%), Positives = 25/59 (42%), Gaps = 8/59 (13%) Frame = -3 Query: 445 PASVHY--------AIRSACCAPRNPTSESWGIPSLKVGSSCGNSSHRSEDLRKDRPSE 293 P HY A+ S P +SW IP VGSS NS+ S D+P++ Sbjct: 368 PQQTHYPKSEQLRAAVESTPSYPNKAPLDSW-IPKGNVGSSSSNSTAPSRSFHTDKPTK 425
>UPPS_HELPY (P55984) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 234 Score = 30.0 bits (66), Expect = 7.2 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -3 Query: 223 WWRRAADIFIPPYLWLWHEPDDMTAIVVEFWQLFRELG 110 W A++F P LW P D+ I+ +F++ R+ G Sbjct: 193 WQSSYAELFFTPILWPDFTPKDLENIISDFYKRVRKFG 230
>UPPS_HELPJ (Q9ZK05) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 234 Score = 30.0 bits (66), Expect = 7.2 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -3 Query: 223 WWRRAADIFIPPYLWLWHEPDDMTAIVVEFWQLFRELG 110 W A++F P LW P D+ I+ +F++ R+ G Sbjct: 193 WQSSYAELFFTPILWPDFTPKDLENIISDFYKRVRKFG 230 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,119,766 Number of Sequences: 219361 Number of extensions: 1662552 Number of successful extensions: 3701 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3701 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7139613222 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)