| Clone Name | rbaal8m21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YO092_YEAST (Q12010) Uncharacterized protein YOL092W | 35 | 0.19 | 2 | STM1_SCHPO (Q10482) Seven transmembrane protein 1 | 30 | 4.6 | 3 | PERN_IPOBA (O04796) Neutral peroxidase precursor (EC 1.11.1.7) (... | 30 | 6.1 | 4 | NODU_AZOCA (Q07759) Nodulation protein U (EC 2.1.3.-) | 30 | 7.9 |
|---|
>YO092_YEAST (Q12010) Uncharacterized protein YOL092W| Length = 308 Score = 35.0 bits (79), Expect = 0.19 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = -3 Query: 637 SILVNSLDWARLRPNLPWLVDAGGCVLLDSFIIFQFLYFHYRKQ 506 S++V SLDW L N WLV + G + +D I QF + K+ Sbjct: 261 SVIVISLDWKYLIMNASWLVGSIGTLFMDFVIFSQFFIYKRNKK 304
>STM1_SCHPO (Q10482) Seven transmembrane protein 1| Length = 271 Score = 30.4 bits (67), Expect = 4.6 Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = -3 Query: 595 NLPWLVDAGGCVLLDSFIIFQFLYF--HY 515 NLPW++ A + LD +I +QF+ + HY Sbjct: 243 NLPWILGAFSTIFLDIYIFYQFIKYRNHY 271
>PERN_IPOBA (O04796) Neutral peroxidase precursor (EC 1.11.1.7) (SwPN1)| Length = 348 Score = 30.0 bits (66), Expect = 6.1 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +3 Query: 357 PCLCSSARGVAIVQLSKKNAQSPCRCSPIS 446 P +S RG +++ +K+NAQ+ C +P+S Sbjct: 126 PANSNSVRGFSVIDQAKRNAQTKCADTPVS 155
>NODU_AZOCA (Q07759) Nodulation protein U (EC 2.1.3.-)| Length = 560 Score = 29.6 bits (65), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 34 EHLDKIGLVPHKKNLQMSNAEPYLESGW 117 EH D+I L H+ Q S+ + Y+ GW Sbjct: 41 EHTDEIALALHRSGFQPSDIDEYIIDGW 68 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 97,119,069 Number of Sequences: 219361 Number of extensions: 1981794 Number of successful extensions: 3922 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3922 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5995743495 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)