| Clone Name | rbasd0e09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MCR_HUMAN (P08235) Mineralocorticoid receptor (MR) | 30 | 3.9 | 2 | TROP_HUMAN (Q12816) Trophinin (MAGE-D3 antigen) | 29 | 8.7 |
|---|
>MCR_HUMAN (P08235) Mineralocorticoid receptor (MR)| Length = 984 Score = 30.0 bits (66), Expect = 3.9 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = -2 Query: 473 GATPVAAPLASEESRSCSPQKGYAESKASRSRSPAIA 363 G+ PV +P+ +CSP AE++ SRS SPA A Sbjct: 221 GSFPVHSPITQGTPLTCSPN---AENRGSRSHSPAHA 254
>TROP_HUMAN (Q12816) Trophinin (MAGE-D3 antigen)| Length = 1387 Score = 28.9 bits (63), Expect = 8.7 Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 4/78 (5%) Frame = +2 Query: 209 YTIIPSTL--FTNIQSHQ--GTL*TIRCLMRLSAPWRRTSSMNCGCAHSFL*NASSQSQV 376 + + PST F+N S GTL T S+ + +S++ GCAHS + SS++ + Sbjct: 715 FGVAPSTSASFSNTASISFGGTLST-------SSSFSSAASISFGCAHSTSTSFSSEASI 767 Query: 377 TCCAMPCFQHILSAENSS 430 + MPC S SS Sbjct: 768 SFGGMPCTSASFSGGVSS 785 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,199,783 Number of Sequences: 219361 Number of extensions: 1251189 Number of successful extensions: 3748 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3747 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3869946934 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)