| Clone Name | rbasd0c06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CRIM1_BRARE (Q7T3Q2) Cysteine-rich motor neuron 1 protein precur... | 28 | 8.2 | 2 | FA24B_HUMAN (Q8N5W8) Protein FAM24B precursor | 28 | 8.2 |
|---|
>CRIM1_BRARE (Q7T3Q2) Cysteine-rich motor neuron 1 protein precursor (CRIM-1)| Length = 1027 Score = 27.7 bits (60), Expect = 8.2 Identities = 14/47 (29%), Positives = 19/47 (40%) Frame = +3 Query: 45 DIDGCVKINFTYRESIILRLLCCALPCAQQQTQAGHTVRVCSSXRDP 185 DID C +++ + C ALPC Q T G +C P Sbjct: 826 DIDSCTHCYCLQGQTLCSTVSCPALPCHQPLTVEGSCCPMCPESYAP 872
>FA24B_HUMAN (Q8N5W8) Protein FAM24B precursor| Length = 94 Score = 27.7 bits (60), Expect = 8.2 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = +2 Query: 92 NTTPALLCSAVCPAADPSRAHCTCLFFXSRPPCFCAWN 205 N+ + + CPA + C F S PPC C N Sbjct: 54 NSQAKTIATESCPALQCCEGYRMCASFDSLPPCCCDIN 91 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,848,600 Number of Sequences: 219361 Number of extensions: 565620 Number of successful extensions: 1272 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1257 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1272 length of database: 80,573,946 effective HSP length: 59 effective length of database: 67,631,647 effective search space used: 1623159528 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)