| Clone Name | rbasd0a03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UBP10_HUMAN (Q14694) Ubiquitin carboxyl-terminal hydrolase 10 (E... | 32 | 1.5 | 2 | POXB_STRPN (Q54970) Pyruvate oxidase (EC 1.2.3.3) (Pyruvic oxida... | 30 | 4.4 | 3 | AMYD_THETU (P37730) Probable starch degradation products transpo... | 29 | 7.5 | 4 | SSG1_AVESA (P12615) 12S seed storage globulin 1 precursor [Conta... | 29 | 9.7 |
|---|
>UBP10_HUMAN (Q14694) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) Length = 798 Score = 31.6 bits (70), Expect = 1.5 Identities = 20/59 (33%), Positives = 27/59 (45%) Frame = +2 Query: 278 RDWLAWSMAASPSLYTGESPTLAVQLASIL**WGEAPGANGLRLHYHGAATLDSPRPGS 454 RD L+ + A P + T + L V IL GE NG+ LH + LD +P S Sbjct: 261 RDTLSRTAGAQPCVGTDTTENLGVANGQILESSGEGTATNGVELHTTESIDLDPTKPES 319
>POXB_STRPN (Q54970) Pyruvate oxidase (EC 1.2.3.3) (Pyruvic oxidase) (POX)| Length = 591 Score = 30.0 bits (66), Expect = 4.4 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -1 Query: 544 KPCWRASPLHATDGVAMPG 488 K WR SPL AT G+A+PG Sbjct: 404 KNMWRTSPLFATMGIALPG 422
>AMYD_THETU (P37730) Probable starch degradation products transport system| permease protein amyD Length = 292 Score = 29.3 bits (64), Expect = 7.5 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 237 FFFFHCFVHTIDSTGIGWLGAWL 305 F F F D+T IGWLG WL Sbjct: 127 FIFVDVFQTISDATHIGWLGGWL 149
>SSG1_AVESA (P12615) 12S seed storage globulin 1 precursor [Contains: 12S seed| storage globulin 1 acidic chain; 12S seed storage globulin 1 basic chain] Length = 518 Score = 28.9 bits (63), Expect = 9.7 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -2 Query: 378 PHHXRMEASWTAKVGDSPVYSEGEAAMLQANQS 280 P + E S +VG SP Y EG++ Q+ QS Sbjct: 279 PIQSQQEQSTQYQVGQSPQYQEGQSTQYQSGQS 311 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,809,567 Number of Sequences: 219361 Number of extensions: 1389376 Number of successful extensions: 3378 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3374 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4315578075 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)