| Clone Name | rbaal41n01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MYSN_ACACA (P05659) Myosin-2 heavy chain, non muscle (Myosin II ... | 30 | 2.9 | 2 | MC5R_BOVIN (P56451) Melanocortin receptor 5 (MC5-R) | 29 | 6.4 | 3 | RBP24_HUMAN (Q4ZG46) Ran-binding protein 2-like 4 (RanBP2L4) | 29 | 8.3 | 4 | GCC2_HUMAN (Q8IWJ2) GRIP and coiled-coil domain-containing prote... | 29 | 8.3 | 5 | M5_STRP5 (P02977) M protein, serotype 5 precursor | 29 | 8.3 |
|---|
>MYSN_ACACA (P05659) Myosin-2 heavy chain, non muscle (Myosin II heavy chain, non| muscle) Length = 1509 Score = 30.4 bits (67), Expect = 2.9 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 5/53 (9%) Frame = -3 Query: 379 KDIKEIRSALQEEKAG-----SKTEQTGQTQEDQVLKTDDEKTEQQTAVKA*K 236 +++ + R+ L+EEK+G SK +Q GQ ED + D K++ A K+ K Sbjct: 1066 EELAQTRAQLEEEKSGKEAASSKAKQLGQQLEDARSEVDSLKSKLSAAEKSLK 1118
>MC5R_BOVIN (P56451) Melanocortin receptor 5 (MC5-R)| Length = 325 Score = 29.3 bits (64), Expect = 6.4 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +3 Query: 69 GSMWQASAMCKPVHIHIYPS*PNVLVLCICLIFWVVQMTKLSIHLHKFCL 218 G +W A C V I Y S +V+C+ +F + + S++ H F L Sbjct: 164 GGIWAFCASCGTVFIVYYES--TYVVICLIAMFLTMLLLMASLYTHMFLL 211
>RBP24_HUMAN (Q4ZG46) Ran-binding protein 2-like 4 (RanBP2L4)| Length = 1583 Score = 28.9 bits (63), Expect = 8.3 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 8/43 (18%) Frame = +3 Query: 375 SLKQQITQCELEMFQGNTE--------SQTAVKRWTERRHTDL 479 +L+QQ+++ E ++FQ E SQ ++K ERR+TDL Sbjct: 1359 TLQQQLSKMEAQLFQLKNEPTTRSPVSSQQSLKNLRERRNTDL 1401
>GCC2_HUMAN (Q8IWJ2) GRIP and coiled-coil domain-containing protein 2 (Golgi| coiled coil protein GCC185) (CTCL tumor antigen se1-1) (CLL-associated antigen KW-11) (NY-REN-53 antigen) Length = 1583 Score = 28.9 bits (63), Expect = 8.3 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 8/43 (18%) Frame = +3 Query: 375 SLKQQITQCELEMFQGNTE--------SQTAVKRWTERRHTDL 479 +L+QQ+++ E ++FQ E SQ ++K ERR+TDL Sbjct: 1359 TLQQQLSKMEAQLFQLKNEPTTRSPVSSQQSLKNLRERRNTDL 1401
>M5_STRP5 (P02977) M protein, serotype 5 precursor| Length = 492 Score = 28.9 bits (63), Expect = 8.3 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -3 Query: 376 DIKEIRSALQEEKAGSKTEQTGQTQEDQVLKTDDEKTEQQ 257 D+K L+ E G KTE G E++ LKT+ ++ E + Sbjct: 68 DLKTKNEGLKTENEGLKTENEGLKTENEGLKTEKKEHEAE 107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,638,602 Number of Sequences: 219361 Number of extensions: 1330702 Number of successful extensions: 3501 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3372 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3494 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3696665728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)