| Clone Name | rbaal41l14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KAPP_ARATH (P46014) Kinase-associated protein phosphatase (EC 3.... | 42 | 4e-04 | 2 | EPOR_PIG (Q9MYZ9) Erythropoietin receptor precursor (EPO-R) | 30 | 1.1 | 3 | REIS_TODPA (P23820) Retinochrome (Retinal photoisomerase) | 29 | 3.2 | 4 | TALA_POVBK (P03071) Large T antigen | 28 | 5.4 | 5 | TALA_POVBA (P14999) Large T antigen | 28 | 5.4 | 6 | EPOR_HUMAN (P19235) Erythropoietin receptor precursor (EPO-R) | 28 | 7.0 | 7 | RECR_BDEBA (Q6MH30) Recombination protein recR | 27 | 9.2 |
|---|
>KAPP_ARATH (P46014) Kinase-associated protein phosphatase (EC 3.1.3.16)| Length = 581 Score = 42.0 bits (97), Expect = 4e-04 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = -3 Query: 377 SQAVAHPDVGSRRWSEPAELADGDIIT 297 S +++HPD+GSR+W P ELA DIIT Sbjct: 256 SHSISHPDLGSRKWGNPVELASDDIIT 282
>EPOR_PIG (Q9MYZ9) Erythropoietin receptor precursor (EPO-R)| Length = 509 Score = 30.4 bits (67), Expect = 1.1 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = +3 Query: 75 EYVYTRVQFD-LCIDKCTGDSYQAEGYSSNALYTNIYIYIRLTIVDPSPVNDVSC 236 +Y+Y V + D +G S + +G SS+ Y+N Y + +PSP N V+C Sbjct: 454 KYLYLVVSDSGISTDYSSGGSQETQGGSSSGPYSNPYENSLVPAPEPSPPNYVTC 508
>REIS_TODPA (P23820) Retinochrome (Retinal photoisomerase)| Length = 301 Score = 28.9 bits (63), Expect = 3.2 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -1 Query: 118 LSIHKSNCTLVYTYSDMSLCSYIF 47 L +H ++CT+ Y+ SD S SY+F Sbjct: 160 LEVHGTSCTINYSVSDESYQSYVF 183
>TALA_POVBK (P03071) Large T antigen| Length = 695 Score = 28.1 bits (61), Expect = 5.4 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = +3 Query: 57 LHNDISEYVYTRVQFDLCIDKCTGDSYQAE 146 L ++IS Y ++R+++++C+ KC D + E Sbjct: 605 LDSEISMYTFSRMKYNICMGKCILDITREE 634
>TALA_POVBA (P14999) Large T antigen| Length = 691 Score = 28.1 bits (61), Expect = 5.4 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = +3 Query: 57 LHNDISEYVYTRVQFDLCIDKCTGDSYQAE 146 L ++IS Y ++R+++++C+ KC D + E Sbjct: 605 LDSEISMYTFSRMKYNICMGKCILDITREE 634
>EPOR_HUMAN (P19235) Erythropoietin receptor precursor (EPO-R)| Length = 508 Score = 27.7 bits (60), Expect = 7.0 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +3 Query: 75 EYVYTRVQFD-LCIDKCTGDSYQAEGYSSNALYTNIYIYIRLTIVDPSPVNDVSC 236 +Y+Y V + D +GDS A+G S+ Y+N Y + +P P + V+C Sbjct: 453 KYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYENSLIPAAEPLPPSYVAC 507
>RECR_BDEBA (Q6MH30) Recombination protein recR| Length = 204 Score = 27.3 bits (59), Expect = 9.2 Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Frame = -1 Query: 235 HETS-LTGDGSTIVNRIYIYILVYNAFELYPSA**ESPVHLSIHKSNCTLVYTYSDMSLC 59 HE S L G G R+ YIL YP E+ + + +C + Y+D +C Sbjct: 12 HELSRLPGIGPKTAQRLAYYIL--RTGNEYPERLSEALLRVKAEVHDCPTCFNYTDTDIC 69 Query: 58 SY 53 Y Sbjct: 70 RY 71 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,546,674 Number of Sequences: 219361 Number of extensions: 876680 Number of successful extensions: 1650 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1650 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)