ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal41j15 |
|---|---|
| Clone Library Name | barley_pub |
>GCSP_FLATR (O49852) Glycine dehydrogenase [decarboxylating], mitochondrial| precursor (EC 1.4.4.2) (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 1034 Score = 52.0 bits (123), Expect = 4e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICTLQ 255 WPTTCRVDNVYGDRNLICTLQ Sbjct: 1001 WPTTCRVDNVYGDRNLICTLQ 1021
>GCSP_FLAAN (O49850) Glycine dehydrogenase [decarboxylating], mitochondrial| precursor (EC 1.4.4.2) (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 1034 Score = 52.0 bits (123), Expect = 4e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICTLQ 255 WPTTCRVDNVYGDRNLICTLQ Sbjct: 1001 WPTTCRVDNVYGDRNLICTLQ 1021
>GCSPB_FLAPR (P49362) Glycine dehydrogenase [decarboxylating] B, mitochondrial| precursor (EC 1.4.4.2) (Glycine decarboxylase B) (Glycine cleavage system P-protein B) Length = 1034 Score = 52.0 bits (123), Expect = 4e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICTLQ 255 WPTTCRVDNVYGDRNLICTLQ Sbjct: 1001 WPTTCRVDNVYGDRNLICTLQ 1021
>GCSPA_FLAPR (P49361) Glycine dehydrogenase [decarboxylating] A, mitochondrial| precursor (EC 1.4.4.2) (Glycine decarboxylase A) (Glycine cleavage system P-protein A) Length = 1037 Score = 52.0 bits (123), Expect = 4e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICTLQ 255 WPTTCRVDNVYGDRNLICTLQ Sbjct: 1004 WPTTCRVDNVYGDRNLICTLQ 1024
>GCSP_ARATH (O80988) Glycine dehydrogenase [decarboxylating], mitochondrial| precursor (EC 1.4.4.2) (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 1044 Score = 47.0 bits (110), Expect = 1e-05 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICTLQ 255 WPTT RVDNVYGDRNL+CTLQ Sbjct: 1011 WPTTGRVDNVYGDRNLVCTLQ 1031
>GCSP_SOLTU (O49954) Glycine dehydrogenase [decarboxylating], mitochondrial| precursor (EC 1.4.4.2) (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 1035 Score = 45.4 bits (106), Expect = 3e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICTL 258 WPTT RVDNVYGDRNLICTL Sbjct: 1002 WPTTGRVDNVYGDRNLICTL 1021
>GCSP_PEA (P26969) Glycine dehydrogenase [decarboxylating], mitochondrial| precursor (EC 1.4.4.2) (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 1057 Score = 45.1 bits (105), Expect = 5e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICTL 258 WPTT RVDNVYGDRNL+CTL Sbjct: 1023 WPTTGRVDNVYGDRNLVCTL 1042
>GCSP2_ARATH (Q94B78) Putative glycine dehydrogenase [decarboxylating] 2,| mitochondrial precursor (EC 1.4.4.2) (Glycine decarboxylase 2) (Glycine cleavage system P-protein 2) Length = 1037 Score = 42.7 bits (99), Expect = 2e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICTL 258 WPTT RVDNVYGDR L+CTL Sbjct: 1005 WPTTGRVDNVYGDRKLVCTL 1024
>GCSP2_COLP3 (Q47XG2) Glycine dehydrogenase [decarboxylating] 2 (EC 1.4.4.2)| (Glycine decarboxylase 2) (Glycine cleavage system P-protein 2) Length = 956 Score = 42.0 bits (97), Expect = 4e-04 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WPTT R+DNVYGDRNLIC+ Sbjct: 926 WPTTNRIDNVYGDRNLICS 944
>GCSP_VIBPA (Q87I05) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 954 Score = 40.4 bits (93), Expect = 0.001 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WPT RVDNVYGDRNLIC+ Sbjct: 927 WPTVNRVDNVYGDRNLICS 945
>GCSP_VIBVY (Q7MEH9) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 954 Score = 40.0 bits (92), Expect = 0.001 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WPT RVDNVYGDRNL+C+ Sbjct: 927 WPTVNRVDNVYGDRNLVCS 945
>GCSP_VIBVU (Q8D7G7) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 954 Score = 40.0 bits (92), Expect = 0.001 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WPT RVDNVYGDRNL+C+ Sbjct: 927 WPTVNRVDNVYGDRNLVCS 945
>GCSP_SYNPX (Q7U3Q5) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 959 Score = 39.3 bits (90), Expect = 0.003 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R+DN YGDRNLICT Sbjct: 928 WPAVARIDNAYGDRNLICT 946
>GCSP_PHOPR (Q6LHN5) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 959 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WPT RVDNV+GDRNLIC+ Sbjct: 931 WPTVNRVDNVFGDRNLICS 949
>GCSP_PSEHT (Q3IFW1) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 963 Score = 38.1 bits (87), Expect = 0.006 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WPT R+D+VYGDRNL+C Sbjct: 936 WPTVTRIDDVYGDRNLVC 953
>GCSP_TROWT (Q83GV1) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 968 Score = 37.4 bits (85), Expect = 0.010 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP + R+DN YGDRN+ CT Sbjct: 944 WPASARIDNAYGDRNIFCT 962
>GCSP_TROW8 (Q83IA7) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 968 Score = 37.4 bits (85), Expect = 0.010 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP + R+DN YGDRN+ CT Sbjct: 944 WPASARIDNAYGDRNIFCT 962
>GCSP_LEPIN (Q8F937) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 964 Score = 37.4 bits (85), Expect = 0.010 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP RVDNVYGDRNL+C+ Sbjct: 938 WPYVGRVDNVYGDRNLVCS 956
>GCSP_LEPIC (Q72VI8) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 964 Score = 37.4 bits (85), Expect = 0.010 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP RVDNVYGDRNL+C+ Sbjct: 938 WPYVGRVDNVYGDRNLVCS 956
>GCSP_SYNEL (Q8DII3) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 954 Score = 37.0 bits (84), Expect = 0.012 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R+DN YGDR+L+CT Sbjct: 929 WPAVARIDNAYGDRHLVCT 947
>GCSP_BORPE (Q7W0E3) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 954 Score = 37.0 bits (84), Expect = 0.012 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WP RVDN YGDRNL+C Sbjct: 928 WPPVARVDNAYGDRNLVC 945
>GCSP_BORPA (Q7W1C4) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 954 Score = 37.0 bits (84), Expect = 0.012 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WP RVDN YGDRNL+C Sbjct: 928 WPPVARVDNAYGDRNLVC 945
>GCSP_BORBR (Q7WP29) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 954 Score = 37.0 bits (84), Expect = 0.012 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WP RVDN YGDRNL+C Sbjct: 928 WPPVARVDNAYGDRNLVC 945
>GCSP_PELUB (Q4FMV1) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 952 Score = 37.0 bits (84), Expect = 0.012 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP RVDNVYGD+NL CT Sbjct: 922 WPPVGRVDNVYGDKNLFCT 940
>GCSP_BDEBA (Q6MPZ6) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 958 Score = 37.0 bits (84), Expect = 0.012 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP RVDN YGDRNLIC+ Sbjct: 931 WPVVGRVDNAYGDRNLICS 949
>GCSP_PROMM (Q7V411) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 962 Score = 36.6 bits (83), Expect = 0.016 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R+DN YGDRNL+C+ Sbjct: 926 WPAVSRIDNAYGDRNLLCS 944
>GCSP_DEIRA (Q9RTF5) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 949 Score = 36.6 bits (83), Expect = 0.016 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP RVDNVYGDRN +C+ Sbjct: 921 WPAVNRVDNVYGDRNFVCS 939
>GCSP2_PSEPK (Q88CI9) Glycine dehydrogenase [decarboxylating] 2 (EC 1.4.4.2)| (Glycine decarboxylase 2) (Glycine cleavage system P-protein 2) Length = 957 Score = 36.6 bits (83), Expect = 0.016 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WP RVDNVYGDRNL C Sbjct: 931 WPAVNRVDNVYGDRNLFC 948
>GCSP2_PSEPF (Q3K4Z1) Glycine dehydrogenase [decarboxylating] 2 (EC 1.4.4.2)| (Glycine decarboxylase 2) (Glycine cleavage system P-protein 2) Length = 957 Score = 36.6 bits (83), Expect = 0.016 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WP RVDNVYGDRNL C Sbjct: 931 WPAVNRVDNVYGDRNLFC 948
>GCSP1_COLP3 (Q486J6) Glycine dehydrogenase [decarboxylating] 1 (EC 1.4.4.2)| (Glycine decarboxylase 1) (Glycine cleavage system P-protein 1) Length = 965 Score = 36.6 bits (83), Expect = 0.016 Identities = 13/19 (68%), Positives = 17/19 (89%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WPT R+D+V+GDRNLIC+ Sbjct: 938 WPTVNRIDDVFGDRNLICS 956
>GCSP2_PSEF5 (Q4K416) Glycine dehydrogenase [decarboxylating] 2 (EC 1.4.4.2)| (Glycine decarboxylase 2) (Glycine cleavage system P-protein 2) Length = 954 Score = 36.6 bits (83), Expect = 0.016 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WP RVDNVYGDRNL C Sbjct: 928 WPAVNRVDNVYGDRNLFC 945
>GCSP2_PSEAE (Q9HTX7) Glycine dehydrogenase [decarboxylating] 2 (EC 1.4.4.2)| (Glycine decarboxylase 2) (Glycine cleavage system P-protein 2) Length = 958 Score = 36.6 bits (83), Expect = 0.016 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WP RVDNVYGDRNL C Sbjct: 931 WPAVNRVDNVYGDRNLFC 948
>GCSP_YEAST (P49095) Glycine dehydrogenase [decarboxylating], mitochondrial| precursor (EC 1.4.4.2) (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 1034 Score = 36.2 bits (82), Expect = 0.021 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WPT R+D+ YGD NLICT Sbjct: 1004 WPTVARLDDTYGDMNLICT 1022
>GCSP_SHEON (Q8EIQ6) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 962 Score = 36.2 bits (82), Expect = 0.021 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WPT R+D+VYGDRNL C Sbjct: 936 WPTVNRIDDVYGDRNLFC 953
>GCSP_RHIME (Q92Q11) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 954 Score = 36.2 bits (82), Expect = 0.021 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 W RVDNVYGDRNL+CT Sbjct: 924 WSPVNRVDNVYGDRNLVCT 942
>GCSP_AGRT5 (Q8UFD6) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 954 Score = 36.2 bits (82), Expect = 0.021 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 W R+DNVYGDRNLICT Sbjct: 924 WSPVNRIDNVYGDRNLICT 942
>GCSP_HUMAN (P23378) Glycine dehydrogenase [decarboxylating], mitochondrial| precursor (EC 1.4.4.2) (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 1020 Score = 36.2 bits (82), Expect = 0.021 Identities = 11/19 (57%), Positives = 17/19 (89%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WPT R+D++YGD++L+CT Sbjct: 983 WPTIARIDDIYGDQHLVCT 1001
>GCSP1_PSEAE (Q9I137) Glycine dehydrogenase [decarboxylating] 1 (EC 1.4.4.2)| (Glycine decarboxylase 1) (Glycine cleavage system P-protein 1) Length = 959 Score = 36.2 bits (82), Expect = 0.021 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP RVDNVYGDRNL C+ Sbjct: 931 WPPVGRVDNVYGDRNLTCS 949
>GCSP_MOUSE (Q91W43) Glycine dehydrogenase [decarboxylating], mitochondrial| precursor (EC 1.4.4.2) (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 1025 Score = 36.2 bits (82), Expect = 0.021 Identities = 11/19 (57%), Positives = 17/19 (89%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WPT R+D++YGD++L+CT Sbjct: 988 WPTIARIDDIYGDQHLVCT 1006
>GCSP_CHICK (P15505) Glycine dehydrogenase [decarboxylating], mitochondrial| precursor (EC 1.4.4.2) (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 1004 Score = 36.2 bits (82), Expect = 0.021 Identities = 11/19 (57%), Positives = 17/19 (89%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WPT R+D++YGD++L+CT Sbjct: 967 WPTIARIDDIYGDQHLVCT 985
>GCSP1_PSEPF (Q3K7X5) Glycine dehydrogenase [decarboxylating] 1 (EC 1.4.4.2)| (Glycine decarboxylase 1) (Glycine cleavage system P-protein 1) Length = 950 Score = 35.8 bits (81), Expect = 0.028 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WP RVDNV+GDRNL+C Sbjct: 924 WPPVGRVDNVFGDRNLVC 941
>GCSP_PSEU2 (Q4ZXH2) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 954 Score = 35.8 bits (81), Expect = 0.028 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WP RVDNV+GDRNL+C Sbjct: 926 WPPVGRVDNVFGDRNLVC 943
>GCSP_PSESM (Q887L5) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 954 Score = 35.8 bits (81), Expect = 0.028 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WP RVDNV+GDRNL+C Sbjct: 926 WPPVGRVDNVFGDRNLVC 943
>GCSP_PSE14 (Q48ME3) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 954 Score = 35.8 bits (81), Expect = 0.028 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WP RVDNV+GDRNL+C Sbjct: 926 WPPVGRVDNVFGDRNLVC 943
>GCSP_SHIFL (Q83QA2) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 956 Score = 35.8 bits (81), Expect = 0.028 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WPT R+D+VYGDRNL C+ Sbjct: 930 WPTVKRLDDVYGDRNLFCS 948
>GCSP_SALTY (Q8ZM76) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 956 Score = 35.8 bits (81), Expect = 0.028 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WPT R+D+VYGDRNL C+ Sbjct: 930 WPTVKRLDDVYGDRNLFCS 948
>GCSP_SALTI (Q8Z3X0) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 956 Score = 35.8 bits (81), Expect = 0.028 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WPT R+D+VYGDRNL C+ Sbjct: 930 WPTVKRLDDVYGDRNLFCS 948
>GCSP_RHOS4 (Q3J4D4) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 956 Score = 35.8 bits (81), Expect = 0.028 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP RVDN +GDRNL+CT Sbjct: 926 WPPVGRVDNAWGDRNLVCT 944
>GCSP_PROMT (Q46IC1) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 968 Score = 35.8 bits (81), Expect = 0.028 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP+ R++N YGDRNLIC+ Sbjct: 937 WPSVSRINNAYGDRNLICS 955
>GCSP_ECOLI (P33195) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 956 Score = 35.8 bits (81), Expect = 0.028 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WPT R+D+VYGDRNL C+ Sbjct: 930 WPTVKRLDDVYGDRNLFCS 948
>GCSP_ECOL6 (Q8FE67) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 956 Score = 35.8 bits (81), Expect = 0.028 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WPT R+D+VYGDRNL C+ Sbjct: 930 WPTVKRLDDVYGDRNLFCS 948
>GCSP_ECO57 (Q8XD33) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 956 Score = 35.8 bits (81), Expect = 0.028 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WPT R+D+VYGDRNL C+ Sbjct: 930 WPTVKRLDDVYGDRNLFCS 948
>GCSP_YERPS (Q666R7) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 959 Score = 35.8 bits (81), Expect = 0.028 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WPT R+D+VYGDRNL C+ Sbjct: 933 WPTVKRLDDVYGDRNLFCS 951
>GCSP1_PSEPK (Q88P65) Glycine dehydrogenase [decarboxylating] 1 (EC 1.4.4.2)| (Glycine decarboxylase 1) (Glycine cleavage system P-protein 1) Length = 951 Score = 35.8 bits (81), Expect = 0.028 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WP RVDNV+GDRNL+C Sbjct: 923 WPPVGRVDNVFGDRNLVC 940
>GCSP1_PSEF5 (Q4K7Q8) Glycine dehydrogenase [decarboxylating] 1 (EC 1.4.4.2)| (Glycine decarboxylase 1) (Glycine cleavage system P-protein 1) Length = 951 Score = 35.8 bits (81), Expect = 0.028 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WP RVDNV+GDRNL+C Sbjct: 923 WPPVGRVDNVFGDRNLVC 940
>GCSP_YERPE (Q8ZHI8) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 958 Score = 35.8 bits (81), Expect = 0.028 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WPT R+D+VYGDRNL C+ Sbjct: 932 WPTVKRLDDVYGDRNLFCS 950
>GCSP_NEIMA (Q9JT86) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 950 Score = 35.4 bits (80), Expect = 0.036 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP RVD+VYGDRNL+C+ Sbjct: 923 WPFVNRVDDVYGDRNLVCS 941
>GCSP_NEIG1 (Q5F761) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 950 Score = 35.4 bits (80), Expect = 0.036 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP RVD+VYGDRNL+C+ Sbjct: 923 WPFVNRVDDVYGDRNLVCS 941
>GCSP_IDILO (Q5R192) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 962 Score = 35.4 bits (80), Expect = 0.036 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WPT R+D+V+GDRNL+C+ Sbjct: 936 WPTVNRIDDVFGDRNLMCS 954
>GCSP_XANAC (Q8PN59) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 977 Score = 35.4 bits (80), Expect = 0.036 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WP RVDNVYGD+N++C Sbjct: 946 WPPVARVDNVYGDKNVMC 963
>GCSP_PROMA (Q7V9K4) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 964 Score = 35.4 bits (80), Expect = 0.036 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R+DN +GDRNL+C+ Sbjct: 936 WPAVSRIDNAFGDRNLVCS 954
>GCSP_RHOPA (Q6N344) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 990 Score = 35.0 bits (79), Expect = 0.047 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 W RVDNVYGDRNLIC+ Sbjct: 954 WSPVGRVDNVYGDRNLICS 972
>GCSP_CHRVO (Q7NSJ5) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 950 Score = 35.0 bits (79), Expect = 0.047 Identities = 11/19 (57%), Positives = 17/19 (89%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP+ R+D+VYGDRN++C+ Sbjct: 924 WPSVNRIDDVYGDRNVVCS 942
>GCSP_BRUSU (Q8FVU9) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 932 Score = 35.0 bits (79), Expect = 0.047 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP RVDNV GDRNLIC+ Sbjct: 906 WPPVSRVDNVGGDRNLICS 924
>GCSP_BRUME (P62921) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 932 Score = 35.0 bits (79), Expect = 0.047 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP RVDNV GDRNLIC+ Sbjct: 906 WPPVSRVDNVGGDRNLICS 924
>GCSP_BRUAB (P62920) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 932 Score = 35.0 bits (79), Expect = 0.047 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP RVDNV GDRNLIC+ Sbjct: 906 WPPVSRVDNVGGDRNLICS 924
>GCSP_BRUA2 (Q2YKX9) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 932 Score = 35.0 bits (79), Expect = 0.047 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP RVDNV GDRNLIC+ Sbjct: 906 WPPVSRVDNVGGDRNLICS 924
>GCSP_RALEJ (Q46VZ5) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 976 Score = 35.0 bits (79), Expect = 0.047 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R DNVYGDRNL C+ Sbjct: 948 WPPVGRADNVYGDRNLFCS 966
>GCSP_BURS3 (Q39KU1) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 975 Score = 35.0 bits (79), Expect = 0.047 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R DNVYGDRNL C+ Sbjct: 949 WPPVGRADNVYGDRNLFCS 967
>GCSP_MYCLE (O32915) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 952 Score = 35.0 bits (79), Expect = 0.047 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R+D VYGDRNL+C+ Sbjct: 926 WPPVRRIDGVYGDRNLVCS 944
>GCSP_RHILO (Q98LT6) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 937 Score = 34.7 bits (78), Expect = 0.062 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R+DNV GDRNL+C+ Sbjct: 907 WPPVSRIDNVAGDRNLVCS 925
>GCSP_BRAJA (Q89I86) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 955 Score = 34.7 bits (78), Expect = 0.062 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 W RVDNVYGDRNL+C+ Sbjct: 925 WSPVGRVDNVYGDRNLVCS 943
>GCSP_RALSO (Q8XU98) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 982 Score = 34.7 bits (78), Expect = 0.062 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WP R DNVYGDRNL C Sbjct: 954 WPPVGRADNVYGDRNLFC 971
>GCSP_AZOSE (Q5NZ93) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 972 Score = 34.7 bits (78), Expect = 0.062 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WP+ R+D+VYGDRNL C Sbjct: 945 WPSVNRIDDVYGDRNLFC 962
>GCSP_PSYAR (Q4FTK9) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 965 Score = 34.3 bits (77), Expect = 0.081 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP+ RVD+ YGD+NL+C+ Sbjct: 939 WPSVARVDDAYGDKNLMCS 957
>GCSP_PROAC (Q6A9R8) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 994 Score = 34.3 bits (77), Expect = 0.081 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP RVDN YGDR+L+C+ Sbjct: 967 WPPVGRVDNTYGDRHLVCS 985
>GCSP_ERWCT (Q6D974) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 957 Score = 34.3 bits (77), Expect = 0.081 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP+ R+D+VYGDRNL C+ Sbjct: 931 WPSVKRLDDVYGDRNLFCS 949
>GCSP_SCHPO (Q09785) Putative glycine dehydrogenase [decarboxylating],| mitochondrial precursor (EC 1.4.4.2) (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 1017 Score = 34.3 bits (77), Expect = 0.081 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP+ R+D+ YGD+NL CT Sbjct: 994 WPSVARLDDAYGDKNLFCT 1012
>GCSP_XANCP (Q8PBK7) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 975 Score = 34.3 bits (77), Expect = 0.081 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WP RVDNVYGD+N++C Sbjct: 944 WPPVGRVDNVYGDKNVMC 961
>GCSP_MYCTU (Q50601) Probable glycine dehydrogenase [decarboxylating] (EC| 1.4.4.2) (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 941 Score = 33.9 bits (76), Expect = 0.11 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R+D YGDRNL+C+ Sbjct: 915 WPAVRRIDGAYGDRNLVCS 933
>GCSP_MYCBO (Q7VET8) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 941 Score = 33.9 bits (76), Expect = 0.11 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R+D YGDRNL+C+ Sbjct: 915 WPAVRRIDGAYGDRNLVCS 933
>GCSP_NOCFA (Q5YWV4) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 934 Score = 33.9 bits (76), Expect = 0.11 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R+D YGDRNL+C+ Sbjct: 907 WPAVRRIDGAYGDRNLVCS 925
>GCSP_XYLFT (Q87DR1) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 993 Score = 33.5 bits (75), Expect = 0.14 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WP RVDNVYGD++++C Sbjct: 949 WPPVARVDNVYGDKHVMC 966
>GCSP_XYLFA (Q9PDJ4) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 993 Score = 33.5 bits (75), Expect = 0.14 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WP RVDNVYGD++++C Sbjct: 949 WPPVARVDNVYGDKHVMC 966
>GCSP_DECAR (Q47D81) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 963 Score = 33.5 bits (75), Expect = 0.14 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLIC 264 WP+ R+D+VYGDRNL C Sbjct: 936 WPSVNRIDDVYGDRNLNC 953
>GCSP_MYCPA (Q73ZQ6) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 941 Score = 33.5 bits (75), Expect = 0.14 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R+D YGDRNL+C+ Sbjct: 915 WPPVRRIDGAYGDRNLVCS 933
>GCSP_STRCO (Q9AK84) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 961 Score = 33.5 bits (75), Expect = 0.14 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R+D YGDRNL+C+ Sbjct: 934 WPPVRRIDQAYGDRNLVCS 952
>GCSP_BURPS (Q63PL2) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 975 Score = 33.5 bits (75), Expect = 0.14 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R DN YGDRNL C+ Sbjct: 949 WPPVGRADNAYGDRNLFCS 967
>GCSP_BURP1 (Q3JY08) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 975 Score = 33.5 bits (75), Expect = 0.14 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R DN YGDRNL C+ Sbjct: 949 WPPVGRADNAYGDRNLFCS 967
>GCSP_BURMA (Q62FN1) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 975 Score = 33.5 bits (75), Expect = 0.14 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R DN YGDRNL C+ Sbjct: 949 WPPVGRADNAYGDRNLFCS 967
>GCSP_SYNY3 (P74416) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 983 Score = 32.7 bits (73), Expect = 0.23 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICTLQ 255 WP R++N YGDR+L+C+ + Sbjct: 955 WPAVGRINNTYGDRHLVCSCE 975
>GCSP_PHOLL (Q7N199) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 958 Score = 32.7 bits (73), Expect = 0.23 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R+D+VYGDRNL C+ Sbjct: 932 WPAVKRLDDVYGDRNLHCS 950
>GCSP_NITWN (Q3ST46) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 954 Score = 32.3 bits (72), Expect = 0.31 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 W RVDN YGDRNL+C+ Sbjct: 924 WCPVGRVDNAYGDRNLVCS 942
>GCSP_BARHE (Q6G2F1) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 931 Score = 32.0 bits (71), Expect = 0.40 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R+DNV GDR LIC+ Sbjct: 905 WPPVSRIDNVAGDRMLICS 923
>GCSP_RHOFA (Q8G9M2) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) (Fragment) Length = 949 Score = 32.0 bits (71), Expect = 0.40 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R+D +GDRNL+C+ Sbjct: 923 WPAVRRIDGAHGDRNLVCS 941
>GCSP_STRAW (Q827D7) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 961 Score = 32.0 bits (71), Expect = 0.40 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R+D +GDRNL+C+ Sbjct: 934 WPPVRRIDQAFGDRNLVCS 952
>GCSP_BARQU (Q6FYZ7) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 931 Score = 31.6 bits (70), Expect = 0.52 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP R+DNV GDR LIC+ Sbjct: 905 WPPVSRIDNVAGDRVLICS 923
>GCSP_ANASP (Q8YNF9) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 983 Score = 30.4 bits (67), Expect = 1.2 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 WP+ R+D +GDRN +C+ Sbjct: 957 WPSVGRIDAAFGDRNFVCS 975
>GCSP_GLUOX (Q5FRY0) Glycine dehydrogenase [decarboxylating] (EC 1.4.4.2)| (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 951 Score = 30.0 bits (66), Expect = 1.5 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 Query: 317 WPTTCRVDNVYGDRNLICT 261 W R+DN +GDRNL+C+ Sbjct: 923 WSPVGRLDNAWGDRNLVCS 941
>SGOL1_HUMAN (Q5FBB7) Shugoshin-like 1 (hSgo1) (Serologically defined breast| cancer antigen NY-BR-85) Length = 561 Score = 27.7 bits (60), Expect = 7.5 Identities = 19/61 (31%), Positives = 26/61 (42%) Frame = +3 Query: 132 SMLPSYRKHHNFLTQYHSSHTRIVIIKRLRGRSCSFLRHLLLQSADQVAIPVHVVHTTCC 311 S+ S +KH N + Q+ S L G+S F R L + IP +V H C Sbjct: 190 SVRSSLKKHCNSICQFDSLDD--FETSHLAGKSFEFERVGFLDPLVNMHIPENVQHNACQ 247 Query: 312 W 314 W Sbjct: 248 W 248
>PI3R5_HUMAN (Q8WYR1) Phosphoinositide 3-kinase regulatory subunit 5 (PI3-kinase| regulatory subunit 5) (PI3-kinase p101 subunit) (PtdIns-3-kinase p101) (p101-PI3K) (Phosphatidylinositol-4,5-bisphosphate 3-kinase regulatory subunit) (PtdIns-3-kinase regula Length = 880 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 83 FSCILCTPTLPPHSHLKVKLA 21 +S +LCTP PP S L +K A Sbjct: 86 YSTVLCTPHFPPDSDLLLKAA 106
>SYS_METMP (O30520) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 514 Score = 27.3 bits (59), Expect = 9.9 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +1 Query: 22 ANFTFKWEWGGSVGVQRIQEKVASE 96 + +T++WE GG+ G+ R+ E + E Sbjct: 339 SGWTYRWEGGGAKGLDRVNEFLRGE 363
>PI3R5_MOUSE (Q5SW28) Phosphoinositide 3-kinase regulatory subunit 5 (PI3-kinase| regulatory subunit 5) (PI3-kinase p101 subunit) (PtdIns-3-kinase p101) (p101-PI3K) (Phosphatidylinositol-4,5-bisphosphate 3-kinase regulatory subunit) (PtdIns-3-kinase regula Length = 871 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 83 FSCILCTPTLPPHSHLKVKLA 21 +S +LCTP PP S L +K A Sbjct: 86 YSTVLCTPHFPPDSDLLLKAA 106
>SYS_METTH (O27194) Seryl-tRNA synthetase (EC 6.1.1.11) (Serine--tRNA ligase)| (SerRS) Length = 513 Score = 27.3 bits (59), Expect = 9.9 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +1 Query: 22 ANFTFKWEWGGSVGVQRIQE 81 + +T++WE GGS G+ R+ E Sbjct: 339 SGWTYRWEAGGSKGLDRVHE 358
>PI3R5_PIG (O02696) Phosphoinositide 3-kinase regulatory subunit 5 (PI3-kinase| regulatory subunit 5) (PI3-kinase p101 subunit) (PtdIns-3-kinase p101) (p101-PI3K) (Phosphatidylinositol-4,5-bisphosphate 3-kinase regulatory subunit) (PtdIns-3-kinase regulato Length = 877 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 83 FSCILCTPTLPPHSHLKVKLA 21 +S +LCTP PP S L +K A Sbjct: 86 YSTVLCTPHFPPDSDLLLKAA 106 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,457,510 Number of Sequences: 219361 Number of extensions: 529225 Number of successful extensions: 1373 Number of sequences better than 10.0: 105 Number of HSP's better than 10.0 without gapping: 1351 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1373 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
