| Clone Name | rbaal41h21 |
|---|---|
| Clone Library Name | barley_pub |
>Y1549_PHOLL (Q7N6K1) UPF0299 membrane protein plu1549| Length = 145 Score = 29.6 bits (65), Expect = 2.2 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = -2 Query: 148 IFAYLSTGTSRHFXHISHRLHHIVFPCPIGSARIHSSILYLSYICHR 8 +F + G ++ +S ++ IVF C I +A + + Y S+ HR Sbjct: 76 LFLPIGVGVMNYYDQLSQQIIPIVFSCLISTAIVMIIVAYSSHYVHR 122
>PFA5_YEAST (Q03289) Palmitoyltransferase PFA5 (EC 2.3.1.-) (Protein fatty| acyltransferase 5) Length = 374 Score = 29.6 bits (65), Expect = 2.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 21 YDKYRIDECIRADPIGHGNTIWCSRCE 101 YD +C ++DP HG IWCS C+ Sbjct: 111 YDAVVPPKCYQSDP--HGYPIWCSECQ 135
>MTCY_LEUME (P38577) Bacteriocin mesentericin Y105 precursor| Length = 61 Score = 29.6 bits (65), Expect = 2.2 Identities = 22/59 (37%), Positives = 30/59 (50%) Frame = +1 Query: 22 MINTESMSVYVRTQ*DMEIQYGVVGAKYGGNGETCRSTSTQKFIYYGSPSPAGHTRLAS 198 M N +S+ Y Q D + VVG KY GNG C T + + +G + AG RLA+ Sbjct: 1 MTNMKSVEAY--QQLDNQNLKKVVGGKYYGNGVHC--TKSGCSVNWGEAASAGIHRLAN 55
>YWZ5_CAEEL (Q11095) Hypothetical protein C02B8.5| Length = 453 Score = 29.3 bits (64), Expect = 2.9 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 75 NTIWCSRCEIWXKWRDVPVDKY 140 N+ WC C + +WR +P D Y Sbjct: 412 NSEWCGLCNLCWQWRKLPADYY 433
>RS13_IDILO (Q5QXV5) 30S ribosomal protein S13| Length = 118 Score = 28.1 bits (61), Expect = 6.4 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +3 Query: 120 DVPVDKYAKIYLLRLTVPGRTHTASILAAXGVVD 221 +VP +K+A I L + GRT + ILAA G+ + Sbjct: 8 NVPDNKHAVIALTAIYGVGRTRSQQILAATGIAE 41
>GLGB_SOLTU (P30924) 1,4-alpha-glucan branching enzyme (EC 2.4.1.18) (Starch| branching enzyme) (Q-enzyme) Length = 861 Score = 28.1 bits (61), Expect = 6.4 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +3 Query: 69 HGNTIWCSRCEIWXKWRDVPVDKYAKIY 152 HGN +W R W K+ K+A Y Sbjct: 213 HGNGVWVDRIPAWIKYATADATKFAAPY 240
>FER_THEAC (P00218) Zinc-containing ferredoxin| Length = 142 Score = 28.1 bits (61), Expect = 6.4 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 21 YDKYRIDECIRADPIGHGNTIWCSRCE 101 ++KYR D+C DP+ + I+C CE Sbjct: 107 WNKYRTDKC---DPVRESDCIFCMACE 130
>RHOC_MOUSE (Q62159) Rho-related GTP-binding protein RhoC precursor| (Silica-induced gene 61 protein) (SIG-61) Length = 193 Score = 27.7 bits (60), Expect = 8.4 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +2 Query: 95 VRNMXEMARRAGRQVRKN 148 VR + EMA RAG QVRKN Sbjct: 167 VREVFEMATRAGLQVRKN 184
>RHOC_HUMAN (P08134) Rho-related GTP-binding protein RhoC precursor (H9)| Length = 193 Score = 27.7 bits (60), Expect = 8.4 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +2 Query: 95 VRNMXEMARRAGRQVRKN 148 VR + EMA RAG QVRKN Sbjct: 167 VREVFEMATRAGLQVRKN 184 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,265,508 Number of Sequences: 219361 Number of extensions: 607325 Number of successful extensions: 1553 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1553 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)