| Clone Name | rbaal9a23 |
|---|---|
| Clone Library Name | barley_pub |
>R1AB_BSCR3 (Q3I5J6) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [Includes:| Replicase polyprotein 1a (pp1a) (ORF1A)] [Contains: Leader protein; p65 homolog; NSP1 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); 3C-like proteinase (EC 3.4.22.-) (3CL-PRO) (3 Length = 7071 Score = 29.6 bits (65), Expect = 6.6 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -1 Query: 208 FVCVEQSWYIRKIFW*GHVYMVIAETDCFI--CCSCYWGI 95 FVCVE Y +F G+ I CF+ CC CY+G+ Sbjct: 3735 FVCVE---YYPLLFITGNTLQCIMLVYCFLGYCCCCYFGL 3771
>UVRC_VIBF1 (Q5E4C5) UvrABC system protein C (Protein uvrC) (Excinuclease ABC| subunit C) Length = 608 Score = 29.6 bits (65), Expect = 6.6 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +2 Query: 62 TKALYSLSHCSNAPITGAANKAISLSYNHVYMPLPKY 172 TKAL S H + +T + +A+ L +N++ LPKY Sbjct: 55 TKALVSHIHQVDVTVTHSETEALILEHNYIKQYLPKY 91
>R1AB_CVHSA (P59641) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [Includes:| Replicase polyprotein 1a (pp1a) (ORF1A)] [Contains: Leader protein; p65 homolog; NSP1 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); 3C-like proteinase (EC 3.4.22.-) (3CL-PRO) (3 Length = 7073 Score = 29.6 bits (65), Expect = 6.6 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -1 Query: 208 FVCVEQSWYIRKIFW*GHVYMVIAETDCFI--CCSCYWGI 95 FVCVE Y +F G+ I CF+ CC CY+G+ Sbjct: 3737 FVCVE---YYPLLFITGNTLQCIMLVYCFLGYCCCCYFGL 3773
>HISX_LEGPL (Q5WX91) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 431 Score = 29.3 bits (64), Expect = 8.6 Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 2/88 (2%) Frame = +2 Query: 62 TKALYSLS--HCSNAPITGAANKAISLSYNHVYMPLPKYFSYVPALLYTNKATSILVGSI 235 T+A+ ++S H S P + A ++ +VY P+ K YVP T +S+L+ +I Sbjct: 83 TQAIGTISSYHQSLLPENTEISTASGITIRNVYRPIQKVGLYVPGGNKTPLVSSLLMQAI 142 Query: 236 TLRTMKSACLLRCQGAGKTESLKEYILL 319 + + C + E+IL+ Sbjct: 143 PAKVAGCPIKVLCTPPDAEGEINEHILV 170
>HISX_LEGPH (Q5ZW87) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 431 Score = 29.3 bits (64), Expect = 8.6 Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 2/88 (2%) Frame = +2 Query: 62 TKALYSLS--HCSNAPITGAANKAISLSYNHVYMPLPKYFSYVPALLYTNKATSILVGSI 235 T+A+ ++S H S P + A ++ +VY P+ K YVP T +S+L+ +I Sbjct: 83 TQAIGTISSYHQSLLPENTEISTASGITIRNVYRPIQKVGLYVPGGNKTPLVSSLLMQAI 142 Query: 236 TLRTMKSACLLRCQGAGKTESLKEYILL 319 + + C + E+IL+ Sbjct: 143 PAKVAGCPIKVLCTPPDAEGEINEHILV 170
>OGG1_RAT (O70249) N-glycosylase/DNA lyase [Includes: 8-oxoguanine DNA| glycosylase (EC 3.2.2.-); DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18) (AP lyase)] Length = 345 Score = 29.3 bits (64), Expect = 8.6 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = -1 Query: 505 RSTIEKPSIWAACPCPDKGLI*ESVLKRPSDLNRREMLSNIWSFV 371 R+ P++WA+ PCP L + VL RE WS V Sbjct: 14 RTLTSSPALWASIPCPRSELRLDLVLASGQSFRWREQSPAHWSGV 58 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,031,626 Number of Sequences: 219361 Number of extensions: 1839387 Number of successful extensions: 4149 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4022 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4148 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)