| Clone Name | rbaal41g20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RLA2_TRYCR (P23632) 60S acidic ribosomal protein P2-A (P) (P-JL5... | 28 | 4.1 | 2 | DPHB_ARCFU (O29866) Probable diphthine synthase (EC 2.1.1.98) (D... | 28 | 6.9 | 3 | YK07_YEAST (P36122) Hypothetical 88.0 kDa protein in GCN3-SAP190... | 27 | 9.0 |
|---|
>RLA2_TRYCR (P23632) 60S acidic ribosomal protein P2-A (P) (P-JL5) (L12E)| Length = 107 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -2 Query: 365 DTVSTSLSLKMVGGQNRQSAFQANLPTRAQA 273 DTV T K+VGG R +A A+ PT A A Sbjct: 51 DTVCTEGKSKLVGGVTRPNAATASAPTAAAA 81
>DPHB_ARCFU (O29866) Probable diphthine synthase (EC 2.1.1.98) (Diphthamide| biosynthesis methyltransferase) Length = 251 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +2 Query: 176 TTVNLKRKRKGKEAKLIFARAHLSAVCVLTGL 271 + + L+ +RKG + ++I + +AVC LTGL Sbjct: 92 SAIKLEAERKGVKTRIIHGASISTAVCGLTGL 123
>YK07_YEAST (P36122) Hypothetical 88.0 kDa protein in GCN3-SAP190 intergenic| region Length = 765 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 102 MCHTNNRCIHT*HNLQHRVHWTDYRPQLILK 194 +CH+ C T H L H ++ Y +L LK Sbjct: 429 LCHSREHCTMTSHELNHLMNIMHYENELELK 459 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,474,911 Number of Sequences: 219361 Number of extensions: 1104097 Number of successful extensions: 2586 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2527 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2586 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)