| Clone Name | rbaal41g19 |
|---|---|
| Clone Library Name | barley_pub |
>ADA10_XENLA (Q8JIY1) ADAM 10 precursor (EC 3.4.24.81) (A disintegrin and| metalloproteinase domain 10) (Kuzbanian protein homolog) (xKuz) Length = 749 Score = 31.6 bits (70), Expect = 1.1 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = +2 Query: 29 YKHNGSVILRRRE--RLARDACMLFIRDSPHRFFSRYVRTHERGYADACPRVRA 184 ++ +G VILR++ + ++ C LFI+ + H F+ RY T E A V+A Sbjct: 201 HEDSGPVILRKKRAAQAEKNTCQLFIQ-TDHLFYKRYGETREAVIAQISSHVKA 253
>XYNA_STRLI (P26514) Endo-1,4-beta-xylanase A precursor (EC 3.2.1.8) (Xylanase| A) (1,4-beta-D-xylan xylanohydrolase A) Length = 477 Score = 30.4 bits (67), Expect = 2.4 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 6/55 (10%) Frame = -2 Query: 304 DGTEVVLWKWCEGDNQRWKIQPYY*AGQRAPCMDRCM------HGSRTYAWTCIG 158 DGT++ LW G NQ+W AG+ D+C+ +GS+ ++C G Sbjct: 374 DGTQLQLWDCHSGTNQQWAATD---AGELRVYGDKCLDAAGTSNGSKVQIYSCWG 425
>SPR2F_MOUSE (O70557) Small proline-rich protein 2F| Length = 76 Score = 30.4 bits (67), Expect = 2.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 388 RCPRPCSPSTAPTRXGSPGCTAP 456 +CP PCSPS P P C P Sbjct: 22 KCPEPCSPSVCPEPCPPPKCPEP 44
>HA33_CLOBO (P46084) Main hemagglutinin component (HA 33 kDa subunit) (HA1)| Length = 285 Score = 29.6 bits (65), Expect = 4.1 Identities = 15/56 (26%), Positives = 27/56 (48%) Frame = -2 Query: 337 LNGDKYHGGVRDGTEVVLWKWCEGDNQRWKIQPYY*AGQRAPCMDRCMHGSRTYAW 170 LN D++ + +VLW+W + Q+W I+ Y + A + +C +R W Sbjct: 157 LNSDRFLSKNLNSQIIVLWQWFDSSRQKWIIE--YNETKSAYTL-KCQENNRYLTW 209
>ACSA_DROME (Q9VP61) Acetyl-coenzyme A synthetase (EC 6.2.1.1) (Acetate--CoA| ligase) (Acyl-activating enzyme) (Acetyl-CoA synthetase) (ACS) (AceCS) Length = 670 Score = 29.3 bits (64), Expect = 5.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 472 SHPVRLVPYNPDFLXESVLWTESRD 398 SH R+ P PD + E + WT+ RD Sbjct: 231 SHLKRVTPCQPDHVEEEIPWTDDRD 255
>M3K12_HUMAN (Q12852) Mitogen-activated protein kinase kinase kinase 12 (EC| 2.7.11.25) (Mixed lineage kinase) (Leucine-zipper protein kinase) (ZPK) (Dual leucine zipper bearing kinase) (DLK) (MAPK-upstream kinase) (MUK) Length = 859 Score = 29.3 bits (64), Expect = 5.4 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 394 PRPCSPSTAPTRXGSPGCTAPDAQGG 471 P P T P+ +PG T+PD+ GG Sbjct: 635 PPPARGDTPPSEGSAPGSTSPDSPGG 660
>LSD1_CAEEL (Q9XWP6) Probable lysine-specific histone demethylase 1 (EC| 1.-.-.-) (Suppressor of presenilin 5) (P110b homolog) Length = 770 Score = 28.5 bits (62), Expect = 9.2 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -2 Query: 172 WTCIGISTLMCTYVSTEETMWAVPDE 95 W+ + S ++CTY+ EE M +PD+ Sbjct: 554 WSSVPGSKVLCTYIVGEEAMLELPDD 579
>M3K12_RAT (Q63796) Mitogen-activated protein kinase kinase kinase 12 (EC| 2.7.11.25) (Mixed lineage kinase) (Leucine-zipper protein kinase) (ZPK) (Dual leucine zipper bearing kinase) (DLK) (MAPK-upstream kinase) (MUK) Length = 888 Score = 28.5 bits (62), Expect = 9.2 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 394 PRPCSPSTAPTRXGSPGCTAPDAQGG 471 P P T P+ +PG T+PD+ GG Sbjct: 668 PPPPQGDTPPSEGSAPGSTSPDSPGG 693
>M3K12_MOUSE (Q60700) Mitogen-activated protein kinase kinase kinase 12 (EC| 2.7.11.25) (Mixed lineage kinase) (Leucine-zipper protein kinase) (ZPK) (Dual leucine zipper bearing kinase) (DLK) (MAPK-upstream kinase) (MUK) Length = 888 Score = 28.5 bits (62), Expect = 9.2 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 394 PRPCSPSTAPTRXGSPGCTAPDAQGG 471 P P T P+ +PG T+PD+ GG Sbjct: 668 PPPPQGDTPPSEGSAPGSTSPDSPGG 693
>SPR2H_MOUSE (O70559) Small proline-rich protein 2H| Length = 108 Score = 28.5 bits (62), Expect = 9.2 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +1 Query: 388 RCPRPCSPSTAPTRXGSPGCTAP 456 +CP PC P P P CT P Sbjct: 58 KCPEPCPPPKCPEPCPPPKCTEP 80 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,435,842 Number of Sequences: 219361 Number of extensions: 1231085 Number of successful extensions: 3670 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3660 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)