ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal41e22 |
|---|---|
| Clone Library Name | barley_pub |
>KNOB_PLAFG (P09346) Knob-associated histidine-rich protein precursor (KAHRP)| (KP) Length = 634 Score = 25.0 bits (53), Expect(2) = 1.7 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 161 RTPPVHRRISGRGKAVHEHAH 223 + P VH+++ G+ +A H H H Sbjct: 93 QAPQVHQQVHGQDQAHHHHHH 113 Score = 23.5 bits (49), Expect(2) = 1.7 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 73 HEHYHHWIGAYVQQEPTQSQH 135 H H+HH + Q P Q+ H Sbjct: 63 HHHHHHHQHQHQHQAPHQAHH 83
>KNOB_PLAFA (P13817) Knob-associated histidine-rich protein precursor (KAHRP)| (HRPI) (Fragment) Length = 473 Score = 25.0 bits (53), Expect(2) = 1.8 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 161 RTPPVHRRISGRGKAVHEHAH 223 + P VH+++ G+ +A H H H Sbjct: 93 QAPQVHQQVHGQDQAHHHHHH 113 Score = 23.5 bits (49), Expect(2) = 1.8 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 73 HEHYHHWIGAYVQQEPTQSQH 135 H H+HH + Q P Q+ H Sbjct: 63 HHHHHHHQHQHQHQAPHQAHH 83
>KNOB_PLAFN (P06719) Knob-associated histidine-rich protein precursor (KAHRP)| Length = 657 Score = 25.0 bits (53), Expect(2) = 2.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 161 RTPPVHRRISGRGKAVHEHAH 223 + P VH+++ G+ +A H H H Sbjct: 97 QAPQVHQQVHGQDQAHHHHHH 117 Score = 22.7 bits (47), Expect(2) = 2.9 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 73 HEHYHHWIGAYVQQEPTQSQH 135 H H+HH + Q P Q+ H Sbjct: 63 HHHHHHHHHHHQHQAPHQAPH 83
>CNTN2_RAT (P22063) Contactin-2 precursor (Axonin-1) (Axonal glycoprotein| TAG-1) (Transient axonal glycoprotein 1) (TAX-1) Length = 1040 Score = 28.5 bits (62), Expect = 4.8 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +2 Query: 89 TGLELMYNRNQRNHSTRYRFPMCLRTPPVHRRISGRGKAVHEHAHRVLGVGEDAAV 256 T ++L ++R NHS ++ + RTPP SG+ K V + + G E A V Sbjct: 624 TTVQLSWSRGFDNHSPIAKYTLQARTPP-----SGKWKQVRTNPVNIEGNAETAQV 674
>CNTN2_MOUSE (Q61330) Contactin-2 precursor (Axonin-1) (Axonal glycoprotein| TAG-1) (Transient axonal glycoprotein 1) (TAX-1) Length = 1040 Score = 28.5 bits (62), Expect = 4.8 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +2 Query: 89 TGLELMYNRNQRNHSTRYRFPMCLRTPPVHRRISGRGKAVHEHAHRVLGVGEDAAV 256 T ++L ++R NHS ++ + RTPP SG+ K V + + G E A V Sbjct: 624 TTVQLSWSRGFDNHSPIAKYTLQARTPP-----SGKWKQVRTNPVNIEGNAETAQV 674
>CNTN2_HUMAN (Q02246) Contactin-2 precursor (Axonin-1) (Axonal glycoprotein| TAG-1) (Transient axonal glycoprotein 1) (TAX-1) Length = 1040 Score = 28.1 bits (61), Expect = 6.2 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +2 Query: 89 TGLELMYNRNQRNHSTRYRFPMCLRTPPVHRRISGRGKAVHEHAHRVLGVGEDAAV 256 T ++L ++R NHS ++ + RTPP +G+ K V + + G E A V Sbjct: 622 TTIQLSWSRGFDNHSPIAKYTLQARTPP-----AGKWKQVRTNPANIEGNAETAQV 672 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,534,939 Number of Sequences: 219361 Number of extensions: 814486 Number of successful extensions: 2432 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2424 length of database: 80,573,946 effective HSP length: 61 effective length of database: 67,192,925 effective search space used: 1612630200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
