| Clone Name | rbaal40o08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NIA3_MAIZE (P49102) Nitrate reductase [NADH] 3 (EC 1.7.1.1) (NR) | 32 | 1.2 | 2 | TNFL6_RAT (P36940) Tumor necrosis factor ligand superfamily memb... | 31 | 3.5 | 3 | ENC_DROME (Q8MSX1) Protein encore | 30 | 6.0 | 4 | FBX42_PONPY (Q5RDA9) F-box only protein 42 | 30 | 6.0 | 5 | FBX42_MOUSE (Q6PDJ6) F-box only protein 42 | 30 | 6.0 | 6 | FBX42_HUMAN (Q6P3S6) F-box only protein 42 | 30 | 6.0 |
|---|
>NIA3_MAIZE (P49102) Nitrate reductase [NADH] 3 (EC 1.7.1.1) (NR)| Length = 889 Score = 32.3 bits (72), Expect = 1.2 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 2/78 (2%) Frame = +1 Query: 127 HECDGFFWLGWVGLGVSNRNQVCINT-TQKSRLIPRMDGWMHCIQLRRKPDGRHGYATPT 303 HE G +L +G+ S R++ ++ + S+ + R+ G H + RHG+ TP Sbjct: 70 HETYGSHYLANLGVEQSVRDEGTVDAWVESSQSLIRLTG-KHSLNGELPRLMRHGFITPV 128 Query: 304 PR-FAHNRSRRGRGSWPT 354 PR + N RG W T Sbjct: 129 PRHYVRNHGPVPRGDWAT 146
>TNFL6_RAT (P36940) Tumor necrosis factor ligand superfamily member 6 (Fas| antigen ligand) (Fas ligand) (CD178 antigen) (CD95L protein) [Contains: Tumor necrosis factor ligand superfamily member 6, membrane form; Tumor necrosis factor ligand superfamily m Length = 278 Score = 30.8 bits (68), Expect = 3.5 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +1 Query: 442 SEQTGPWSPPSL*SGTRCPTAGGRPR*GTESPAPPP 549 S T PW+PP S CP++G R G P PPP Sbjct: 17 SSATSPWAPPG--SVFSCPSSGPRGP-GQRRPPPPP 49
>ENC_DROME (Q8MSX1) Protein encore| Length = 1818 Score = 30.0 bits (66), Expect = 6.0 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = -1 Query: 265 GGAGCNASIH--PSSVLGDSSELYLCRPDSCC*HPTQPNPTKKSH 137 GG+G + S + P+S++G S P++ P QP PT SH Sbjct: 1604 GGSGSHESSNNSPNSIVGSQSNSAANTPNAAAPPPPQPQPTLVSH 1648
>FBX42_PONPY (Q5RDA9) F-box only protein 42| Length = 717 Score = 30.0 bits (66), Expect = 6.0 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 5/51 (9%) Frame = -2 Query: 231 PRY*ATLLSCIYADLIPVAD--TQPNPT---QPKKAITFMCIFSPSKHWWS 94 P+ ATL+ +Y DL+ + T+P+P QP++ + +SPSK+WW+ Sbjct: 173 PKAGATLV--VYKDLLVLFGGWTRPSPYPLHQPERFFDEIHTYSPSKNWWN 221
>FBX42_MOUSE (Q6PDJ6) F-box only protein 42| Length = 717 Score = 30.0 bits (66), Expect = 6.0 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 5/51 (9%) Frame = -2 Query: 231 PRY*ATLLSCIYADLIPVAD--TQPNPT---QPKKAITFMCIFSPSKHWWS 94 P+ ATL+ +Y DL+ + T+P+P QP++ + +SPSK+WW+ Sbjct: 173 PKAGATLV--VYKDLLVLFGGWTRPSPYPLHQPERFFDEIHTYSPSKNWWN 221
>FBX42_HUMAN (Q6P3S6) F-box only protein 42| Length = 717 Score = 30.0 bits (66), Expect = 6.0 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 5/51 (9%) Frame = -2 Query: 231 PRY*ATLLSCIYADLIPVAD--TQPNPT---QPKKAITFMCIFSPSKHWWS 94 P+ ATL+ +Y DL+ + T+P+P QP++ + +SPSK+WW+ Sbjct: 173 PKAGATLV--VYKDLLVLFGGWTRPSPYPLHQPERFFDEIHTYSPSKNWWN 221 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 101,553,948 Number of Sequences: 219361 Number of extensions: 2283178 Number of successful extensions: 6451 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6097 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6448 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5938641176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)