| Clone Name | rbaal40m15 |
|---|---|
| Clone Library Name | barley_pub |
>TRABD_HUMAN (Q9UGI0) TRABID protein (Zinc finger Ran-binding domain-containing| protein 1) Length = 708 Score = 35.8 bits (81), Expect = 0.094 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 452 WTCDQCTYVNPRSAKACQACDH 387 WTC CTY N AK C CDH Sbjct: 153 WTCSVCTYENWAKAKRCVVCDH 174 Score = 31.6 bits (70), Expect = 1.8 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 470 VDDSNIWTCDQCTYVNPRSAKACQACDHQHR 378 ++++N W+C CTY+N A C C Q R Sbjct: 82 MENANKWSCHMCTYLNWPRAIRCTQCLSQRR 112
>NEIL3_HUMAN (Q8TAT5) Endonuclease VIII-like 3 (Nei-like 3) (DNA glycosylase| FPG2) Length = 605 Score = 33.5 bits (75), Expect = 0.47 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 452 WTCDQCTYVNPRSAKACQAC 393 WTC CT +N S+KAC AC Sbjct: 321 WTCVVCTLINKPSSKACDAC 340
>NEIL3_MOUSE (Q8K203) Endonuclease VIII-like 3 (Nei-like 3) (DNA glycosylase| FPG2) Length = 606 Score = 32.7 bits (73), Expect = 0.80 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 452 WTCDQCTYVNPRSAKACQAC 393 W+C CT +N SAKAC AC Sbjct: 322 WSCVVCTLINRPSAKACDAC 341
>TAMO_DROME (Q9W1A4) Protein tamozhennic| Length = 797 Score = 32.3 bits (72), Expect = 1.0 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -1 Query: 470 VDDSNIWTCDQCTYVNPRSAKACQAC 393 V N W+C CT++NP + + C+ C Sbjct: 736 VTSPNEWSCSFCTFLNPDTKRICEMC 761
>CAND_DROME (P27398) Calpain D (EC 3.4.22.-) (Calcium-activated neutral| proteinase D) (CANP D) (Small optic lobes protein) Length = 1594 Score = 30.8 bits (68), Expect = 3.0 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 452 WTCDQCTYVNPRSAKACQAC 393 WTC +CT VN +A AC C Sbjct: 708 WTCKKCTLVNYSTAMACVVC 727
>RBP2_MOUSE (Q9ERU9) Ran-binding protein 2 (RanBP2)| Length = 3053 Score = 30.0 bits (66), Expect = 5.2 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 Query: 452 WTCDQCTYVNPRSAKACQACDH 387 W C C N RSAK C AC++ Sbjct: 1473 WECSVCLVRNERSAKKCVACEN 1494
>TAB3_MOUSE (Q571K4) Mitogen-activated protein kinase kinase kinase| 7-interacting protein 3 (TAK1-binding protein 3) Length = 716 Score = 30.0 bits (66), Expect = 5.2 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 452 WTCDQCTYVNPRSAKACQACD 390 W CD CT++N + C+ C+ Sbjct: 691 WNCDSCTFLNHPALNRCEQCE 711
>TAB3_HUMAN (Q8N5C8) Mitogen-activated protein kinase kinase kinase| 7-interacting protein 3 (TAK1-binding protein 3) (NF-kappa-B-activating protein 1) Length = 712 Score = 30.0 bits (66), Expect = 5.2 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 452 WTCDQCTYVNPRSAKACQACD 390 W CD CT++N + C+ C+ Sbjct: 687 WNCDSCTFLNHPALNRCEQCE 707
>TAB2_BRARE (Q5RFW2) Mitogen-activated protein kinase kinase kinase| 7-interacting protein 2 homolog Length = 711 Score = 29.6 bits (65), Expect = 6.7 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -1 Query: 467 DDSNIWTCDQCTYVNPRSAKACQACD 390 DD W+C CT++N + C+ C+ Sbjct: 681 DDGVQWSCTACTFLNHPALNRCEECE 706
>RYBP_BRARE (Q5EG55) RING1 and YY1-binding protein (Death effector| domain-associated factor) (DED-associated factor) Length = 257 Score = 29.6 bits (65), Expect = 6.7 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -1 Query: 464 DSNIWTCDQCTYVNPRSAKACQACD 390 D+ W C CT+ N A C CD Sbjct: 19 DNGFWDCSVCTFRNSAEAFKCSICD 43
>STM_ARATH (Q38874) Homeobox protein SHOOT MERISTEMLESS| Length = 382 Score = 29.3 bits (64), Expect = 8.8 Identities = 22/82 (26%), Positives = 33/82 (40%), Gaps = 5/82 (6%) Frame = +2 Query: 50 RKELVLWWSTHLSTPYIDETKQSYRYSLCTQRTGWCPRG*GAVSQWTNNADTRKPRP--- 220 R++L+ WWS H PY E ++ + TG + ++ W N R +P Sbjct: 296 RQQLLDWWSRHYKWPYPSEQQK----LALAESTGLDQK---QINNWFINQRKRHWKPSED 348 Query: 221 --FVCSTLLMPPHSSSPNILSN 280 FV P H N+L N Sbjct: 349 MQFVVMDATHPHHYFMDNVLGN 370
>RYBP_MOUSE (Q8CCI5) RING1 and YY1-binding protein (Death effector| domain-associated factor) (DED-associated factor) Length = 228 Score = 29.3 bits (64), Expect = 8.8 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = -1 Query: 464 DSNIWTCDQCTYVNPRSAKACQACD 390 D W C CT+ N A C CD Sbjct: 21 DEGFWDCSVCTFRNSAEAFKCSICD 45
>RYBP_HUMAN (Q8N488) RING1 and YY1-binding protein (Death effector| domain-associated factor) (DED-associated factor) (YY1 and E4TF1-associated factor 1) (Apoptin-associating protein 1) (APAP-1) Length = 228 Score = 29.3 bits (64), Expect = 8.8 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = -1 Query: 464 DSNIWTCDQCTYVNPRSAKACQACD 390 D W C CT+ N A C CD Sbjct: 21 DEGFWDCSVCTFRNSAEAFKCSICD 45 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,697,418 Number of Sequences: 219361 Number of extensions: 1525140 Number of successful extensions: 4187 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 4060 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4187 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5101629520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)