| Clone Name | rbaal40l24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LEU3_PICJA (P08791) 3-isopropylmalate dehydrogenase (EC 1.1.1.85... | 29 | 3.7 | 2 | LCR74_ARATH (Q9FFP8) Putative low-molecular-weight cysteine-rich... | 28 | 8.3 | 3 | YD3B_SCHPO (Q10275) Hypothetical protein C13G7.11 in chromosome I | 28 | 8.3 |
|---|
>LEU3_PICJA (P08791) 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (Beta-IPM| dehydrogenase) (IMDH) (3-IPM-DH) Length = 363 Score = 28.9 bits (63), Expect = 3.7 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 70 LYVKFRPCNVCSETMVDVTGSTGETLGALTLVV 168 LY RPCN SE+++D++ E + VV Sbjct: 101 LYANLRPCNFASESLLDLSPIKAEVVKGTDFVV 133
>LCR74_ARATH (Q9FFP8) Putative low-molecular-weight cysteine-rich protein LCR74| precursor Length = 73 Score = 27.7 bits (60), Expect = 8.3 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -2 Query: 153 RSQGFTGGACHIHHRFAAYITR 88 R++GF+GG CH HR Y TR Sbjct: 51 RNEGFSGGRCHGFHR-RCYCTR 71
>YD3B_SCHPO (Q10275) Hypothetical protein C13G7.11 in chromosome I| Length = 269 Score = 27.7 bits (60), Expect = 8.3 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 134 VEPVTSTIVSLHTLHGLNFTYRYCFRGFVNKCNN 33 +EP+ +T LH + F +RY F G+ N N Sbjct: 58 IEPIDNTSFFLHPFKKIRFWWRYLFYGWWNLKKN 91 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,196,455 Number of Sequences: 219361 Number of extensions: 641936 Number of successful extensions: 1513 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1490 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1513 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)