| Clone Name | rbaal40l23 |
|---|---|
| Clone Library Name | barley_pub |
>PETM_SPIOL (P80883) Cytochrome b6-f complex subunit 7 (Cytochrome b6-f complex| subunit VII) (Cytochrome b6-f complex subunit petM) (Fragment) Length = 36 Score = 49.3 bits (116), Expect = 4e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -3 Query: 298 NAAGEIFQIAVVMNALTLVGVAVGFVLLR 212 NAA EIF+IA VMN LTLVGVA+GFVLLR Sbjct: 1 NAAAEIFRIAAVMNGLTLVGVAIGFVLLR 29
>PETM_CHLRE (Q42496) Cytochrome b6-f complex subunit 7, chloroplast precursor| (Cytochrome b6-f complex subunit VII) (Cytochrome b6-f complex subunit petM) (Cytochrome b6-f complex 4 kDa subunit) Length = 99 Score = 33.5 bits (75), Expect = 0.22 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 10/56 (17%) Frame = -3 Query: 349 SLSPAGKRRGGTFGAQCNAAGEIFQIA----------VVMNALTLVGVAVGFVLLR 212 SL AG++ + G A E+ IA + M +TLVG+A+GFVLLR Sbjct: 34 SLRTAGQKAAPSRGVATKAVNELAMIAGEAEFIAGTALTMVGMTLVGLAIGFVLLR 89
>PETM_CYAPA (P48366) Cytochrome b6-f complex subunit 7 (Cytochrome b6-f complex| subunit VII) (Cytochrome b6-f complex subunit petM) Length = 33 Score = 31.2 bits (69), Expect = 1.1 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = -3 Query: 286 EIFQIAVVMNALTLVGVAVGFVLLR 212 +IF AV+ LTL+G+++GFVLL+ Sbjct: 4 QIFNTAVICFTLTLIGLSLGFVLLK 28
>PETM_GLOVI (Q7NLN8) Cytochrome b6-f complex subunit 7 (Cytochrome b6-f complex| subunit VII) (Cytochrome b6-f complex subunit petM) Length = 36 Score = 30.8 bits (68), Expect = 1.4 Identities = 14/26 (53%), Positives = 21/26 (80%) Frame = -3 Query: 289 GEIFQIAVVMNALTLVGVAVGFVLLR 212 GEIF +A ++ LTLVG+A+GF +L+ Sbjct: 3 GEIFFVAGLVFVLTLVGMAIGFGVLK 28
>PETM_EMIHU (Q4G3B3) Cytochrome b6-f complex subunit 7 (Cytochrome b6-f complex| subunit VII) (Cytochrome b6-f complex subunit petM) Length = 32 Score = 30.8 bits (68), Expect = 1.4 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = -3 Query: 292 AGEIFQIAVVMNALTLVGVAVGFVLLR 212 A EIF +A VM AL L G++VGF LL+ Sbjct: 2 AKEIFTVAGVMWALVLTGLSVGFGLLK 28
>PETM_PORPU (P51275) Cytochrome b6-f complex subunit 7 (Cytochrome b6-f complex| subunit VII) (Cytochrome b6-f complex subunit petM) Length = 32 Score = 30.0 bits (66), Expect = 2.4 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = -3 Query: 286 EIFQIAVVMNALTLVGVAVGFVLLR 212 EI + A++ + L LVG+AVGF+LL+ Sbjct: 4 EIVESAILSSVLVLVGLAVGFLLLK 28
>PETM_SYNEL (Q8DJ15) Cytochrome b6-f complex subunit 7 (Cytochrome b6-f complex| subunit VII) (Cytochrome b6-f complex subunit petM) Length = 33 Score = 29.6 bits (65), Expect = 3.2 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -3 Query: 292 AGEIFQIAVVMNALTLVGVAVGFVLLR 212 A EIF AV+ L LVG+ G++LLR Sbjct: 2 AEEIFNTAVITFTLVLVGLGAGYLLLR 28 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,829,286 Number of Sequences: 219361 Number of extensions: 816253 Number of successful extensions: 2170 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2170 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)