| Clone Name | rbaal41a20 |
|---|---|
| Clone Library Name | barley_pub |
>PSAN_HORVU (P31093) Photosystem I reaction center subunit N, chloroplast| precursor (PSI-N) Length = 145 Score = 96.7 bits (239), Expect = 1e-20 Identities = 41/46 (89%), Positives = 41/46 (89%) Frame = -2 Query: 217 CKFPYNFTXCQXLXKXXKVPFITDDLEIECEGKEKFKCGSNVFWKW 80 CKFPYNFT CQ L K KVPFITDDLEIECEGKEKFKCGSNVFWKW Sbjct: 100 CKFPYNFTGCQDLAKQKKVPFITDDLEIECEGKEKFKCGSNVFWKW 145
>PSAN_MAIZE (O65107) Photosystem I reaction center subunit N, chloroplast| precursor (PSI-N) (Fragment) Length = 112 Score = 93.6 bits (231), Expect = 1e-19 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -2 Query: 217 CKFPYNFTXCQXLXKXXKVPFITDDLEIECEGKEKFKCGSNVFWKW 80 C+FPYNFT CQ L K KVPFI+DDLEIECEGKEKFKCGSNVFWKW Sbjct: 67 CQFPYNFTGCQDLAKQKKVPFISDDLEIECEGKEKFKCGSNVFWKW 112
>PSAN_ARATH (P49107) Photosystem I reaction center subunit N, chloroplast| precursor (PSI-N) Length = 171 Score = 84.0 bits (206), Expect = 1e-16 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -2 Query: 217 CKFPYNFTXCQXLXKXXKVPFITDDLEIECEGKEKFKCGSNVFWKW 80 CKFP NFT CQ L K KVPFI++D+ +ECEGK+K+KCGSNVFWKW Sbjct: 126 CKFPENFTGCQDLAKQKKVPFISEDIALECEGKDKYKCGSNVFWKW 171
>PSAN_VOLCA (Q9SBN5) Photosystem I reaction center subunit N, chloroplast| precursor (PSI-N) Length = 139 Score = 47.4 bits (111), Expect = 1e-05 Identities = 20/40 (50%), Positives = 26/40 (65%) Frame = -2 Query: 217 CKFPYNFTXCQXLXKXXKVPFITDDLEIECEGKEKFKCGS 98 C+FP NF C+ L V +I +DL+IECEGK+ CGS Sbjct: 93 CQFPENFFGCEELAFNKGVKYIAEDLKIECEGKDAKSCGS 132
>SYI_PROMM (Q7TUN3) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 968 Score = 27.7 bits (60), Expect = 8.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 23 TSRYSLTDIHQHSPYRPASPFPE 91 TSRY L ++H P R A P PE Sbjct: 690 TSRYLLGNLHDFDPERDAIPVPE 712
>LIFR_RAT (O70535) Leukemia inhibitory factor receptor precursor (LIF| receptor) (LIF-R) (CD118 antigen) Length = 1093 Score = 27.7 bits (60), Expect = 8.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 115 KFKCGSNVFWKW*SWS 68 + +C S FWKW WS Sbjct: 504 RVRCSSETFWKWSKWS 519 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,199,382 Number of Sequences: 219361 Number of extensions: 243051 Number of successful extensions: 584 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 582 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 584 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)