| Clone Name | rbaal40l19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | L_PI2HT (P26676) Large structural protein (Protein L) (Transcrip... | 30 | 1.1 |
|---|
>L_PI2HT (P26676) Large structural protein (Protein L) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2262 Score = 30.4 bits (67), Expect = 1.1 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = +1 Query: 1 YIFPLR*NMQPNTCSVVXTSYKPICTNSS*FHDKCTRSYVYNTNNPAHT 147 Y FP M P +V T Y +C ++ D + Y+YN NP T Sbjct: 1629 YTFPKIKGMPPEEKCLVLTEYLAMCYQNTHHLDPDLQKYLYNLTNPKLT 1677 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,172,563 Number of Sequences: 219361 Number of extensions: 896109 Number of successful extensions: 1592 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1582 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1592 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)