| Clone Name | rbaal41a17 |
|---|---|
| Clone Library Name | barley_pub |
>GATE_METAC (Q8TM08) Glutamyl-tRNA(Gln) amidotransferase subunit E (EC 6.3.5.-)| (Glu-ADT subunit E) Length = 633 Score = 29.6 bits (65), Expect = 1.8 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = -2 Query: 407 LIHKVDEITKKVDSVVGPIIDVVMKE-KGERGGVVDKEPKRKETDN 273 ++ K D I K S +GP++ +VMKE +G G + +KE DN Sbjct: 583 VMEKGDFIKDKGPSALGPLMGIVMKEYRGTVDGKILSHMLKKEIDN 628
>GCY_ARBPU (P11528) Resact receptor precursor (Guanylate cyclase) (EC 4.6.1.2)| Length = 986 Score = 28.5 bits (62), Expect = 4.0 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = +2 Query: 95 QNFVTKPKLMTMIQEPNDNDKLEVL--LGTYHHCIYCYIHSVHSND*QLVISIR 250 Q F K +++ I ++ +K ++ +GTY I C IH+VH N L ++R Sbjct: 559 QGFSMKSMVLSAISVISNAEKQQIFATIGTYRGTI-CAIHAVHKNHIDLTRAVR 611
>GCY_STRPU (P16065) Speract receptor precursor (Guanylate cyclase) (EC| 4.6.1.2) Length = 1125 Score = 28.1 bits (61), Expect = 5.2 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = +2 Query: 95 QNFVTKPKLMTMIQEPNDNDKLEVL--LGTYHHCIYCYIHSVHSND*QLVISIR 250 Q F K +M+ I ++ +K ++ +GTY + C +H+VH N L ++R Sbjct: 562 QGFSMKNMVMSAISVISNAEKQQIFATIGTYRGTV-CALHAVHKNHIDLTRAVR 614
>DPOD_YEAST (P15436) DNA polymerase delta catalytic subunit (EC 2.7.7.7) (DNA| polymerase III) Length = 1097 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 46 YSTSPSIPFQQIYIRFPKFCNKTKT 120 YS +PF +IY+ +P NK +T Sbjct: 205 YSGDTKLPFWKIYVTYPHMVNKLRT 229
>KINH_GIBMO (Q86Z98) Kinesin heavy chain| Length = 931 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -2 Query: 389 EITKKVDSVVGPIIDVVMKEKGERGGVVDKEPKRK 285 E+T ++D V ++DV M K E G +D++ KRK Sbjct: 523 ELTTELDEVKQQLLDVKMSAK-ESGAALDEKEKRK 556
>MOAA_RHILO (Q98MK6) Molybdenum cofactor biosynthesis protein A| Length = 331 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 267 RNMSYLRIDITSCQSFECTECI 202 R +SYLR+ +T F CT C+ Sbjct: 9 RTISYLRVSVTDRCDFRCTYCM 30
>SECA_SPIOL (Q36795) Preprotein translocase secA subunit, chloroplast precursor| Length = 1036 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 40 NNYSTSPSIPFQQIYIRFPKFCNKTKT 120 N T SI +Q +++FPK C T T Sbjct: 432 NETITLASISYQNFFLQFPKLCGMTGT 458
>SECA_ARATH (Q9SYI0) Preprotein translocase secA subunit, chloroplast precursor| Length = 1021 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 40 NNYSTSPSIPFQQIYIRFPKFCNKTKT 120 N T SI +Q +++FPK C T T Sbjct: 423 NESITLASISYQNFFLQFPKLCGMTGT 449
>SECA_PEA (Q41062) Preprotein translocase secA subunit, chloroplast precursor| Length = 1011 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 40 NNYSTSPSIPFQQIYIRFPKFCNKTKT 120 N T SI +Q +++FPK C T T Sbjct: 410 NETVTLASISYQNFFLQFPKLCGMTGT 436 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,075,360 Number of Sequences: 219361 Number of extensions: 889083 Number of successful extensions: 2179 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2163 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2179 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)