ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal40j20 |
|---|---|
| Clone Library Name | barley_pub |
>MSH6_ARATH (O04716) DNA mismatch repair protein MSH6-1 (AtMsh6-1)| Length = 1324 Score = 35.0 bits (79), Expect = 0.20 Identities = 16/64 (25%), Positives = 33/64 (51%), Gaps = 2/64 (3%) Frame = -1 Query: 470 GNDAIGKRIEIQLASDGKWHQGVVS--NVISGMLCVQLDNGSSENLELGNQAVRLIAQRL 297 G++ +GK++ + D KW+ G V+ + G V+ ++G E+L+LG + + Sbjct: 121 GDEVVGKQVRVYWPLDKKWYDGSVTFYDKGEGKHVVEYEDGEEESLDLGKEKTEWVVGEK 180 Query: 296 KGGK 285 G + Sbjct: 181 SGDR 184
>LRRN1_RAT (Q32Q07) Leucine-rich repeats neuronal protein 1 precursor| (Neuronal leucine-rich repeat protein 1) (NLRR-1) Length = 716 Score = 32.7 bits (73), Expect = 0.97 Identities = 18/49 (36%), Positives = 29/49 (59%) Frame = +1 Query: 457 IASLPNLRSIQVASIASSPVLCPCLLDGVLPSEPSILSVEGLFLFDLWP 603 + SLPNLR I SI S+P+ C C++ + ++ +I +E L +F P Sbjct: 357 VESLPNLREI---SIHSNPLRCDCVIHWINSNKTNIRFMEPLSMFCAMP 402
>LRRN1_MOUSE (Q61809) Leucine-rich repeats neuronal protein 1 precursor| (Neuronal leucine-rich repeat protein 1) (NLRR-1) Length = 716 Score = 32.7 bits (73), Expect = 0.97 Identities = 18/49 (36%), Positives = 29/49 (59%) Frame = +1 Query: 457 IASLPNLRSIQVASIASSPVLCPCLLDGVLPSEPSILSVEGLFLFDLWP 603 + SLPNLR I SI S+P+ C C++ + ++ +I +E L +F P Sbjct: 357 VESLPNLREI---SIHSNPLRCDCVIHWINSNKTNIRFMEPLSMFCAMP 402
>LRRN1_HUMAN (Q6UXK5) Leucine-rich repeats neuronal protein 1 precursor| (Neuronal leucine-rich repeat protein 1) (NLRR-1) Length = 716 Score = 32.7 bits (73), Expect = 0.97 Identities = 18/49 (36%), Positives = 29/49 (59%) Frame = +1 Query: 457 IASLPNLRSIQVASIASSPVLCPCLLDGVLPSEPSILSVEGLFLFDLWP 603 + SLPNLR I SI S+P+ C C++ + ++ +I +E L +F P Sbjct: 357 VESLPNLREI---SIHSNPLRCDCVIHWINSNKTNIRFMEPLSMFCAMP 402
>TR150_HUMAN (Q9Y2W1) Thyroid hormone receptor-associated protein 3 (Thyroid| hormone receptor-associated protein complex 150 kDa component) (Trap150) Length = 955 Score = 31.2 bits (69), Expect = 2.8 Identities = 17/50 (34%), Positives = 29/50 (58%) Frame = -1 Query: 635 ASQQXDLNVAKGQRSKRKRPSTDKMDGSEGSTPSKRHGQSTGDEAMDATW 486 +S + N ++ + SKRK + +K S+ S PS+ G + GDEA + T+ Sbjct: 158 SSSRSSSNHSRVESSKRKS-AKEKKSSSKDSRPSQAAGDNQGDEAKEQTF 206
>TR150_RAT (Q5M7V8) Thyroid hormone receptor-associated protein 3 (Thyroid| hormone receptor-associated protein complex 150 kDa component) (Trap150) Length = 951 Score = 31.2 bits (69), Expect = 2.8 Identities = 17/50 (34%), Positives = 29/50 (58%) Frame = -1 Query: 635 ASQQXDLNVAKGQRSKRKRPSTDKMDGSEGSTPSKRHGQSTGDEAMDATW 486 +S + N ++ + SKRK + +K S+ S PS+ G + GDEA + T+ Sbjct: 158 SSSRSSSNHSRVESSKRKS-TKEKKSSSKDSRPSQAAGDNQGDEAKEQTF 206
>TR150_MOUSE (Q569Z6) Thyroid hormone receptor-associated protein 3 (Thyroid| hormone receptor-associated protein complex 150 kDa component) (Trap150) Length = 951 Score = 31.2 bits (69), Expect = 2.8 Identities = 17/50 (34%), Positives = 29/50 (58%) Frame = -1 Query: 635 ASQQXDLNVAKGQRSKRKRPSTDKMDGSEGSTPSKRHGQSTGDEAMDATW 486 +S + N ++ + SKRK + +K S+ S PS+ G + GDEA + T+ Sbjct: 158 SSSRSSSNHSRVESSKRKS-TKEKKSSSKDSRPSQAAGDNQGDEAKEQTF 206
>TR150_XENLA (Q5BJ39) Thyroid hormone receptor-associated protein 3 (Thyroid| hormone receptor-associated protein complex 150 kDa component) (Trap150) Length = 951 Score = 30.8 bits (68), Expect = 3.7 Identities = 17/50 (34%), Positives = 29/50 (58%) Frame = -1 Query: 635 ASQQXDLNVAKGQRSKRKRPSTDKMDGSEGSTPSKRHGQSTGDEAMDATW 486 +S + N ++ + SKRK + +K S+ S PS+ G + GDEA + T+ Sbjct: 158 SSSRLSSNHSRVESSKRKS-TKEKKSSSKDSRPSQAAGDNQGDEAKEQTF 206
>RK15_PEA (P31165) 50S ribosomal protein L15, chloroplast precursor (CL15)| (Fragment) Length = 258 Score = 30.4 bits (67), Expect = 4.8 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = +1 Query: 448 LFPIASLPNLRSI---QVASIASSPVLCPCL 531 L P++SLP+L S V ++ + P LCPCL Sbjct: 6 LIPVSSLPSLASPFKGNVKTLVAKPCLCPCL 36
>LRRN3_PONPY (Q5R482) Leucine-rich repeats neuronal protein 3 precursor| (Neuronal leucine-rich repeat protein 3) (NLRR-3) Length = 708 Score = 30.0 bits (66), Expect = 6.3 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 2/60 (3%) Frame = +1 Query: 430 ANWISILF--PIASLPNLRSIQVASIASSPVLCPCLLDGVLPSEPSILSVEGLFLFDLWP 603 +N +S L+ I SLPNL+ I SI S+P+ C C++ + ++ +I +E LF + P Sbjct: 343 SNALSALYHGTIESLPNLKEI---SIHSNPIRCDCVIRWINMNKTNIRFMEPDSLFCVDP 399
>ILVD2_BORPA (Q7W497) Dihydroxy-acid dehydratase 2 (EC 4.2.1.9) (DAD 2)| Length = 561 Score = 30.0 bits (66), Expect = 6.3 Identities = 20/54 (37%), Positives = 28/54 (51%) Frame = -1 Query: 542 TPSKRHGQSTGDEAMDATWILRKLGNDAIGKRIEIQLASDGKWHQGVVSNVISG 381 TP+ G S G E M + +LR++ D I+ A+ G+W GVV VI G Sbjct: 77 TPTISDGMSMGTEGMKYSLVLREVIADC------IETAAQGQWMDGVV--VIGG 122
>LRRN3_RAT (Q9ESY6) Leucine-rich repeats neuronal protein 3 precursor| (Neuronal leucine-rich repeat protein 3) (NLRR-3) Length = 707 Score = 30.0 bits (66), Expect = 6.3 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 2/60 (3%) Frame = +1 Query: 430 ANWISILF--PIASLPNLRSIQVASIASSPVLCPCLLDGVLPSEPSILSVEGLFLFDLWP 603 +N +S L+ I SLPNL+ I SI S+P+ C C++ + ++ +I +E LF + P Sbjct: 343 SNALSALYHGTIESLPNLKEI---SIHSNPIRCDCVIRWINMNKTNIRFMEPDSLFCVDP 399
>GLT4_WHEAT (P08489) Glutenin, high molecular weight subunit PW212 precursor| Length = 838 Score = 30.0 bits (66), Expect = 6.3 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = -2 Query: 535 PRGMGRAQAMKQWMRPGYCASWAMMQLGRGLRSN*LLMGNGIKGWYPMS 389 P+ G+ Q QW +PG Q G L S L +G G +G+YP S Sbjct: 650 PQESGQGQQPGQWQQPGQWQQPGQGQPGYYLTSP-LQLGQGQQGYYPTS 697
>LRRN3_MOUSE (Q8CBC6) Leucine-rich repeats neuronal protein 3 precursor| (Neuronal leucine-rich repeat protein 3) (NLRR-3) Length = 707 Score = 29.6 bits (65), Expect = 8.2 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = +1 Query: 433 NWISILF--PIASLPNLRSIQVASIASSPVLCPCLLDGVLPSEPSILSVEGLFLFDLWP 603 N +S L+ I SLPNL+ I SI S+P+ C C++ + ++ +I +E LF + P Sbjct: 344 NALSALYHGTIESLPNLKEI---SIHSNPIRCDCVIRWINMNKTNIRFMEPDSLFCVDP 399 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 97,230,857 Number of Sequences: 219361 Number of extensions: 2034742 Number of successful extensions: 6198 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 6005 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6192 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6200242422 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
