| Clone Name | rbaal40g08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YCAY_CLOKL (P38943) Hypothetical transport protein in cat1 5'reg... | 31 | 4.5 | 2 | DNAJ2_PROAC (Q6A662) Chaperone protein dnaJ 2 | 30 | 7.7 |
|---|
>YCAY_CLOKL (P38943) Hypothetical transport protein in cat1 5'region (ORFY)| Length = 311 Score = 30.8 bits (68), Expect = 4.5 Identities = 22/72 (30%), Positives = 34/72 (47%) Frame = -1 Query: 606 VTVQAVTEILTIQAVTEILSVQAVTEILAVQAVTEILAFQAVTESVIMTVTAGIVTITGS 427 + ++AV I + A+ E +V A T L A+ +LA + ES+ + V GIV I Sbjct: 227 IFIKAVGYICYLGAIKETSAVTASTVFLIKPALATVLAILILGESIEVNVVIGIVFIIIG 286 Query: 426 GIQKKKGITEAN 391 I +AN Sbjct: 287 SIINYSSNKKAN 298
>DNAJ2_PROAC (Q6A662) Chaperone protein dnaJ 2| Length = 380 Score = 30.0 bits (66), Expect = 7.7 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -1 Query: 672 PHFVVVQVGRGLTVTVQFTTEKVTVQAVTEILTIQAVTEILSVQAVT 532 PH + + G LTVTV T + T+ A E+ T+ T L + A T Sbjct: 273 PHEIFGRDGHNLTVTVPVTFPEATLGAEVEVPTLAGTTVRLRIPAGT 319 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,341,134 Number of Sequences: 219361 Number of extensions: 1223684 Number of successful extensions: 3152 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2936 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3137 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7649585595 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)