| Clone Name | rbaal40f07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | S12A5_MOUSE (Q91V14) Solute carrier family 12 member 5 (Electron... | 29 | 7.2 | 2 | PUR8_DEIRA (Q9RSE6) Adenylosuccinate lyase (EC 4.3.2.2) (Adenylo... | 29 | 7.2 | 3 | S12A5_RAT (Q63633) Solute carrier family 12 member 5 (Electroneu... | 29 | 7.2 | 4 | S12A5_HUMAN (Q9H2X9) Solute carrier family 12 member 5 (Electron... | 29 | 7.2 | 5 | ZN575_HUMAN (Q86XF7) Zinc finger protein 575 | 29 | 9.3 |
|---|
>S12A5_MOUSE (Q91V14) Solute carrier family 12 member 5 (Electroneutral| potassium-chloride cotransporter 2) (K-Cl cotransporter 2) (Neuronal K-Cl cotransporter) (mKCC2) Length = 1115 Score = 29.3 bits (64), Expect = 7.2 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = -2 Query: 218 MCSSFVNSYCCIRWLSSGPDWSSKYRLAPGSWQSSG-SKC-*YFFLCSSYF 72 MC FVN C ++ L P+W ++R + G S C F+CS Y+ Sbjct: 567 MCYMFVNLACAVQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICSWYY 617
>PUR8_DEIRA (Q9RSE6) Adenylosuccinate lyase (EC 4.3.2.2) (Adenylosuccinase)| (ASL) Length = 435 Score = 29.3 bits (64), Expect = 7.2 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 261 DLTTAADFLSLHEHGVAAYHTVFPSRDFNNLQDLQGLILT 380 D T +A + + GV VFP R NL DL GL+ + Sbjct: 321 DATASASYATRRLTGVLRDLVVFPERMLKNLDDLGGLVFS 360
>S12A5_RAT (Q63633) Solute carrier family 12 member 5 (Electroneutral| potassium-chloride cotransporter 2) (K-Cl cotransporter 2) (Neuronal K-Cl cotransporter) (Furosemide-sensitive K-Cl cotransporter) (rKCC2) Length = 1116 Score = 29.3 bits (64), Expect = 7.2 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = -2 Query: 218 MCSSFVNSYCCIRWLSSGPDWSSKYRLAPGSWQSSG-SKC-*YFFLCSSYF 72 MC FVN C ++ L P+W ++R + G S C F+CS Y+ Sbjct: 567 MCYMFVNLACAVQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICSWYY 617
>S12A5_HUMAN (Q9H2X9) Solute carrier family 12 member 5 (Electroneutral| potassium-chloride cotransporter 2) (Erythroid K-Cl cotransporter 2) (Neuronal K-Cl cotransporter) (hKCC2) Length = 1116 Score = 29.3 bits (64), Expect = 7.2 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = -2 Query: 218 MCSSFVNSYCCIRWLSSGPDWSSKYRLAPGSWQSSG-SKC-*YFFLCSSYF 72 MC FVN C ++ L P+W ++R + G S C F+CS Y+ Sbjct: 567 MCYMFVNLACAVQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICSWYY 617
>ZN575_HUMAN (Q86XF7) Zinc finger protein 575| Length = 245 Score = 28.9 bits (63), Expect = 9.3 Identities = 21/63 (33%), Positives = 24/63 (38%), Gaps = 4/63 (6%) Frame = +2 Query: 239 PPCYLGFRPDNSRRLPVTT*TRCSSISHGFSFPRL----QQLTGSAGPHPNCDDIKV*GH 406 P G P RR P RC FS+P + G A PHP D K + Sbjct: 43 PTASAGSPPRPRRRPPPQRPHRCPDCDKAFSYPSKLATHRLAHGGARPHPCPDCPKAFSY 102 Query: 407 PSK 415 PSK Sbjct: 103 PSK 105 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,057,290 Number of Sequences: 219361 Number of extensions: 1488120 Number of successful extensions: 3161 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3064 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3160 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4142954952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)