| Clone Name | rbaal39m13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UL10_HCMVA (P16843) Hypothetical protein UL10 | 30 | 3.9 | 2 | GLYA2_PSEAE (Q9I138) Serine hydroxymethyltransferase 2 (EC 2.1.2... | 29 | 5.1 | 3 | ZN679_HUMAN (Q8IYX0) Zinc finger protein 679 | 29 | 6.7 |
|---|
>UL10_HCMVA (P16843) Hypothetical protein UL10| Length = 258 Score = 29.6 bits (65), Expect = 3.9 Identities = 16/45 (35%), Positives = 20/45 (44%) Frame = -1 Query: 378 SLVETATRQIKPGNGFARLMTITTPQKHEKGINPTQSALPKDENV 244 SL+ T KPG TTP KH + T+ P+D NV Sbjct: 140 SLISRTTTTRKPGQKTTLSRLKTTPNKHTQHKRSTRRTSPRDYNV 184
>GLYA2_PSEAE (Q9I138) Serine hydroxymethyltransferase 2 (EC 2.1.2.1) (Serine| methylase 2) (SHMT 2) Length = 418 Score = 29.3 bits (64), Expect = 5.1 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -3 Query: 400 FHEGECEVSSGNCNQTNQTWQWICEVDDDYNSPEA*E 290 F EGEC +G WIC++ DD ++PE E Sbjct: 374 FREGECRELAG----------WICDILDDIDNPEVGE 400
>ZN679_HUMAN (Q8IYX0) Zinc finger protein 679| Length = 411 Score = 28.9 bits (63), Expect = 6.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -3 Query: 391 GECEVSSGNCNQTNQ 347 GECEV G CN+ NQ Sbjct: 132 GECEVQKGGCNEVNQ 146 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,404,246 Number of Sequences: 219361 Number of extensions: 1167145 Number of successful extensions: 3160 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3085 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3160 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)