| Clone Name | rbaal39l19 |
|---|---|
| Clone Library Name | barley_pub |
>HHEX_MOUSE (P43120) Homeobox protein PRH (Hematopoietically expressed| homeobox) (Homeobox protein HEX) Length = 271 Score = 32.0 bits (71), Expect = 0.37 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = +1 Query: 241 NNGFKHLITGFRTWVHQDPSCHPTLSPKADQALTGSLGKSACSG--YPSP 384 N+ F L++ +RT V++ HP S AL + G S G YP P Sbjct: 56 NSSFTSLVSSYRTPVYEPTPVHPAFSHHPAAALAAAYGPSGFGGPLYPFP 105
>HHEX_HUMAN (Q03014) Homeobox protein PRH (Hematopoietically expressed| homeobox) (Homeobox protein HEX) Length = 270 Score = 30.4 bits (67), Expect = 1.1 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = +1 Query: 241 NNGFKHLITGFRTWVHQDPSCHPTLSPKADQALTGSLGKSACSG--YPSP 384 N+ F L++ +RT V++ HP S + AL + G G YP P Sbjct: 55 NSSFTSLVSPYRTPVYEPTPIHPAFSHHSAAALAAAYGPGGFGGPLYPFP 104
>PICO_DROME (Q9V7S5) Putative inorganic phosphate cotransporter| Length = 529 Score = 29.3 bits (64), Expect = 2.4 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +1 Query: 271 FRTWVHQDPSCHPTLSPKADQALTGSL-GKSACSGYPSP 384 F +VH+DPS HPT+ + + + SL G P P Sbjct: 248 FLIFVHEDPSSHPTIDEREKKYINDSLWGTDVVKSPPIP 286
>SUFS_WIGBR (Q8D2J7) Cysteine desulfurase (EC 2.8.1.7) (Selenocysteine lyase)| (EC 4.4.1.16) (Selenocysteine reductase) (Selenocysteine beta-lyase) (SCL) Length = 410 Score = 28.9 bits (63), Expect = 3.1 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +3 Query: 24 ICTYINSDLENEVYLVALTCANHTFPSTGTSETFLLEQDQMGIQIMEHH 170 I +IN+ ++E+ V T + ETF+ + D + I MEHH Sbjct: 76 IAKFINAKSDSEIIFVKGTTEGINLVANTWGETFIKKGDNIVITQMEHH 124
>KCRU_MOUSE (P30275) Creatine kinase, ubiquitous mitochondrial precursor (EC| 2.7.3.2) (U-MtCK) (Mia-CK) (Acidic-type mitochondrial creatine kinase) Length = 418 Score = 28.1 bits (61), Expect = 5.3 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -1 Query: 357 LPQRPGQRLVSLG*EGGMTRGVLMDPST 274 L RPG RL++L G +T G+L+ P + Sbjct: 9 LSARPGLRLLALAGAGSLTAGILLRPES 36
>ATPG_MYCPN (Q50330) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 279 Score = 27.3 bits (59), Expect = 9.1 Identities = 20/93 (21%), Positives = 41/93 (44%), Gaps = 5/93 (5%) Frame = -1 Query: 300 RGVLMDPSTETSDKVLETIIAVLKISLFSSVCIMLV*IKQLMVSDA-P*SVFPFDLVLVR 124 R + D + SD+++E + +CI+ K ++ A VFPFD+ + + Sbjct: 134 RDLSFDYCQQVSDQIMEQF----DLHQLDRICIIYTQFKNPLIQHANSFQVFPFDVAMFK 189 Query: 123 RFHLFPLREMYDL----HR*VQPNRPRFLDLSL 37 F+ + + D ++ P+F D++L Sbjct: 190 AFNPVKMEQKLDFEPDEETIIKLISPQFFDIAL 222 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,834,208 Number of Sequences: 219361 Number of extensions: 1156975 Number of successful extensions: 2769 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2769 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)