| Clone Name | rbaal39h22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATP4_PEA (Q41000) ATP synthase delta' chain, mitochondrial precu... | 30 | 5.7 |
|---|
>ATP4_PEA (Q41000) ATP synthase delta' chain, mitochondrial precursor (EC| 3.6.3.14) Length = 197 Score = 30.4 bits (67), Expect = 5.7 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +3 Query: 6 ELLAVQVPVEITVPTKINCNFLSDSTQQTEQKRIASPVFSVHSG 137 E L + PV T+PTK+ NF+ + Q K + S + +G Sbjct: 51 EFLKTRPPVPSTIPTKLTVNFVLPYSSQLAAKEVDSVIIPATTG 94 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,021,906 Number of Sequences: 219361 Number of extensions: 1238938 Number of successful extensions: 2815 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2808 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7366267610 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)